PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK07741.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 428aa    MW: 46987.4 Da    PI: 6.4388
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK07741.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.9e-1757102147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+W++eEd  l ++v ++G ++W++Iar ++ gR++k+c++rw + 
        PK07741.1  57 KGPWSPEEDVVLSRLVSKFGARNWSLIARGIP-GRSGKSCRLRWCNQ 102
                      79******************************.***********985 PP

2Myb_DNA-binding58.31.7e-18109153147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T+eEd l+v a++ +G++ W++Iar ++ gRt++ +k++w++ 
        PK07741.1 109 RKPFTEEEDRLIVTAHAIHGNK-WAAIARLLP-GRTDNAIKNHWNST 153
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.89452103IPR017930Myb domain
SuperFamilySSF466892.97E-3154150IPR009057Homeodomain-like
SMARTSM007179.5E-1556105IPR001005SANT/Myb domain
PfamPF002492.4E-1657102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2558110IPR009057Homeodomain-like
CDDcd001674.79E-1459101No hitNo description
PROSITE profilePS5129426.368104158IPR017930Myb domain
SMARTSM007175.5E-18108156IPR001005SANT/Myb domain
PfamPF002494.2E-16109153IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-24111157IPR009057Homeodomain-like
CDDcd001671.37E-13111154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MTVPNDAVSN DDDRTDGFKL GGGGGGEAEL LELRVSDRVC VGAGSGDGDG GGDGRVKGPW  60
SPEEDVVLSR LVSKFGARNW SLIARGIPGR SGKSCRLRWC NQLDPCVKRK PFTEEEDRLI  120
VTAHAIHGNK WAAIARLLPG RTDNAIKNHW NSTLKRKYPE CGRFNTGPEE MVIDGSLDKR  180
RSSSEETMSV EIMNPLRNLE GGDISVENRP FQYGNSAQVN QGCIDEANYH NLASEAPRHT  240
IISRPVARIS AFSVYDPLNG LKHSSVPRTV AAHETLSQAS RSDFGSCKYF REKCSEHMTP  300
LQCGHGCCAN SNQSQTRSSL LGPDFIEYEE GPSFPSNELI SIVTELNNIA WMRSGLENSR  360
ARMSDHTTIV EIFQGSTSTA QVGMSERNRT KDHLRFDEGR NKLMGMMTDA LSSQMQSFAM  420
PAEVEGLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-41561576107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010106095.11e-180Transcription factor
TrEMBLW9S1781e-180W9S178_9R
STRINGVIT_08s0007g01540.t011e-133(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39863362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.13e-94myb domain protein 109