PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK07031.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 321aa    MW: 35167.1 Da    PI: 7.7342
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK07031.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.6e-3949109262
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                ++++l+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknkk s
  PK07031.1  49 PQEQLNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGTLRNVPVGGGSRKNKKPS 109
                6899******************************************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2748107IPR003851Zinc finger, Dof-type
PfamPF027011.7E-3351107IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.09653107IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105591IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MDTTAQWQHE ESGFVGMGEL MGSNMNNNNN NKNSNIDNGS SGDQKRSRPQ EQLNCPRCNS  60
TNTKFCYYNN YSLTQPRYFC KTCRRYWTEG GTLRNVPVGG GSRKNKKPST TNTTNTTTTS  120
NNINNDHMMM INTATINLTP QNLMLSSSYN NSNNNNHHDQ AGTGQDLNLG FQSNKVHPPP  180
PSSSSLGVNG SSTRQLLMYP SGFPFQDHEF KSSNNLGFCG SSSNNVLDHH GLGLGNRYST  240
TTTTGHSYNG MVQDHDQNHE NNGGTILFPF GDLKQTVSSN GTTAADEVNI IHDHHHHHHH  300
QIKGQGNPTG YWTGLLGGGG G
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2P5BYV22e-73A0A2P5BYV2_PARAD; Zinc finger transcription factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.31e-39Dof family protein