PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK06791.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family SBP
Protein Properties Length: 1013aa    MW: 112059 Da    PI: 6.3796
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK06791.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1322.1e-41153230178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +Cqve+C adl++ak+yhrrhkvCe+hska ++lv +++qrfCqqCsrfh+l+efDe+krsCrrrLa+hn+rrrk+++
  PK06791.1 153 ICQVEDCGADLTNAKDYHRRHKVCEMHSKAVKALVGNVMQRFCQQCSRFHALQEFDEGKRSCRRRLAGHNKRRRKTNP 230
                5**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.5E-33147215IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.052151228IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-38152233IPR004333Transcription factor, SBP-box
PfamPF031109.6E-30154227IPR004333Transcription factor, SBP-box
SuperFamilySSF484036.88E-7782895IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.7E-6783897IPR020683Ankyrin repeat-containing domain
CDDcd002044.08E-6783901No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1013 aa     Download sequence    Send to blast
MEARFGGEPR HFFGMSSADL TTVRKRTMEW DLNQWKWDGD LFIASSVNPA VPSEGMGRQF  60
FPAGGSCNSN TSSSCSDEGN LVIEKGKREL EKRRRDNTVE DENLNDGTGN LTLMLGGRGH  120
HLHQQASERE MVNWEGNSGK KTKFVGGTSS RAICQVEDCG ADLTNAKDYH RRHKVCEMHS  180
KAVKALVGNV MQRFCQQCSR FHALQEFDEG KRSCRRRLAG HNKRRRKTNP DTAANGNSLS  240
DDQTSGYLLI SLLRILSNMH SNKPDQSTEQ DLLSHLLKSL ANQTSEQGGK SVAGLLRDPQ  300
NLLTDGTSVG NSEVVSAFLS NGSQGPPRPT KQNHAVSISE IPQQDIHLHN TNGGSVQATS  360
EKPSIINSPP SYSEARDSTA GHSKMNNFDL NDIYIDSDDG VEDPERSSPP TNLVTSSLDC  420
PSWVQQDSHQ SSPPQTNSDS ASAQSPSSSN GEAQSRTDRI VFKLFGKEPN DFPLVLRAQI  480
LDWLSHSPSD IESYIKPGCI ILTIYLRQSD SAWEELCYDI SSKLSRLLDV SDDTFWSTGW  540
TFIRVQHQIA FVCNGQVIVD TSLPLRSSNC SKIVSIKPIA LPASKKAQFL VRGTNLVRPT  600
TRLFCALEGK YLVQEATHEL MDGVDNSEHD EHCISFSCPI DVTNGRGFIE IEDQGLGNSF  660
FPFLVAEEDV CSEIRVLESV LEYTESHAVV GGIGKPESYN QAMDFIHEMG WLLHRSQLRS  720
RLGELDPNAE PFSLKRFKWI MEFSVDHDWC AVVRKLLDIL IDGSIGEGED RSLDLALSEI  780
GLLHRAVRRN SKALVEALLK YAPKDLSKLE SEEKSATHGP SSNFLFRPDV AGPGGLTPLH  840
IAAGKDGSED VLDALTNDPG MVGIEAWKSA RDSTGSTPED YARLRGHYTY IRLIQRKINK  900
NSGSGHVVVD IPGDQKHCGA NQKQNELANT TTATTTFEIG RSEQRRIQRP CGLCDRKLAY  960
GTSRRSVVYR PAMLSMVAIA AVCVCVALLF KSSPEVLYVF QPFRWEMLEF GTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-31147227484squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBM25215497Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010091413.10.0Squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLW9QN820.0W9QN82_9R
STRINGPOPTR_0002s18970.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1