PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK06779.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 328aa    MW: 36936.8 Da    PI: 6.7204
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK06779.3genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
        PK06779.3 14 KGPWTPEEDIILVSYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding483e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T  E++ ++++ ++lG++ W++Ia++++  Rt++++k++w++yl
        PK06779.3  67 RGNFTDNEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTYL 112
                      89********************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.805965IPR017930Myb domain
SuperFamilySSF466894.77E-3011108IPR009057Homeodomain-like
SMARTSM007172.0E-141363IPR001005SANT/Myb domain
PfamPF002493.3E-161461IPR001005SANT/Myb domain
CDDcd001671.06E-101661No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2465116IPR009057Homeodomain-like
SMARTSM007173.3E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129419.49466116IPR017930Myb domain
PfamPF002492.3E-1467112IPR001005SANT/Myb domain
CDDcd001671.82E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009617Biological Processresponse to bacterium
GO:0009626Biological Processplant-type hypersensitive response
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042761Biological Processvery long-chain fatty acid biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGRPPCCDKE GVKKGPWTPE EDIILVSYIQ EHGPGNWRAV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TDNEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT YLKKKLSKIQ  120
NQSSSRDDHE EGFSSSQPSM SRGQWERRLQ TDIHLAKQAL SEALSPEKST SLTHHDQKPS  180
SSSSDQTLST TTTYASSTEN ISRLLKSWMR NPPIKRSGGT TTTTTTTTTT TTTSSTNTTL  240
PNNNVDLSEA FESLFGFESF ESSNNNSDFS QSPDQDHESK PNIGNNAHQL PFSLLEKWLF  300
DETVTTTTTQ GKEVVLSDMI LDENPNFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-251411658159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-251411658159MYB PROTO-ONCOGENE PROTEIN
1h8a_C2e-251411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00386DAPTransfer from AT3G28910Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2295701e-113KP229570.1 UNVERIFIED: Boehmeria nivea MYB transcription factor-like (MYB14) mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010105629.11e-145Myb-related protein 306
SwissprotQ9SCU71e-121MYB30_ARATH; Transcription factor MYB30
TrEMBLW9RS481e-145W9RS48_9R
STRINGVIT_14s0108g00830.t011e-135(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.11e-103myb domain protein 30