PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK06427.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family WOX
Protein Properties Length: 84aa    MW: 9706.42 Da    PI: 11.0542
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK06427.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.62.9e-15255957
               HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox  9 keqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
               +eq+++Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  PK06427.1  2 PEQIRILEAIFNSgMVNPPRDEIRRIRAQLqeygQVGDANVFYWFQNRKSRSKH 55
               79**********99*************************************995 PP

2Wus_type_Homeobox100.31.5e-322561064
  Wus_type_Homeobox 10 peQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       peQi+iLe++++sG+++P+++ei+ri+a+L+eyG+++d+NVfyWFQNrk+R+++k
          PK06427.1  2 PEQIRILEAIFNSGMVNPPRDEIRRIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 56
                       89***************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003890.0095160IPR001356Homeobox domain
PROSITE profilePS5007110.463156IPR001356Homeobox domain
SuperFamilySSF466897.7E-11260IPR009057Homeodomain-like
PfamPF000466.7E-13255IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-6254IPR009057Homeodomain-like
CDDcd000862.07E-5256No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
XPEQIRILEA IFNSGMVNPP RDEIRRIRAQ LQEYGQVGDA NVFYWFQNRK SRSKHKLRHL  60
QNSIQQNLQN PTPTPPSSAT APSX
Functional Description ? help Back to Top
Source Description
UniProtHomeodomain transcription factor required for meristem growth and early development (PubMed:15753038). Promotes cell proliferation and prevents premature differentiation in meristematic tissues during postembryonic development (PubMed:15753038). Essential for maintaining tissue growth during embryogenesis (PubMed:17706632). May act by repressing TSS to promote meristematic proliferation (PubMed:21185286). Involved in the transcriptional activation of a subset of cytokinin response factors (PubMed:20110319). May act as a negative regulator of cytokinin signaling in the dark (PubMed:21057190). {ECO:0000269|PubMed:15753038, ECO:0000269|PubMed:17706632, ECO:0000269|PubMed:20110319, ECO:0000269|PubMed:21057190, ECO:0000303|PubMed:21185286}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in the zygote after fertilization by the transcription factor WRKY2. {ECO:0000269|PubMed:21316593}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012092417.12e-41WUSCHEL-related homeobox 9
RefseqXP_020230917.13e-41WUSCHEL-related homeobox 9
RefseqXP_020541150.12e-41WUSCHEL-related homeobox 9
SwissprotQ6X7J48e-35WOX9_ARATH; WUSCHEL-related homeobox 9
TrEMBLA0A067JE435e-40A0A067JE43_JATCU; Uncharacterized protein
TrEMBLA0A151SAT55e-40A0A151SAT5_CAJCA; WUSCHEL-related homeobox 9
STRINGcassava4.1_023871m2e-39(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.18e-37homeobox-3
Publications ? help Back to Top
  1. Wang W, et al.
    Dwarf Tiller1, a Wuschel-related homeobox transcription factor, is required for tiller growth in rice.
    PLoS Genet., 2014. 10(3): p. e1004154
    [PMID:24625559]
  2. Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
    Wuschel-related homeobox 8/9 is important for proper embryo patterning in the gymnosperm Norway spruce.
    J. Exp. Bot., 2014. 65(22): p. 6543-52
    [PMID:25205582]
  3. Raines T, et al.
    The cytokinin response factors modulate root and shoot growth and promote leaf senescence in Arabidopsis.
    Plant J., 2016. 85(1): p. 134-47
    [PMID:26662515]
  4. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]
  5. Blein T,Pautot V,Laufs P
    Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection.
    Plants (Basel), 2013. 2(2): p. 230-47
    [PMID:27137374]