PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK06396.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 511aa    MW: 58767.8 Da    PI: 9.4266
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK06396.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding292.4e-0969114146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r++WT+eEd+ l+  v++ G  +W  Ia+ + ++Rt+ qc  r+q 
        PK06396.1  69 RNPWTAEEDKYLLLFVQEKGISNWIDIAASLRTNRTPFQCLARYQR 114
                      79******************************************96 PP

2Myb_DNA-binding31.25.1e-10123166246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        WT+++d +l  av+ +G  +W ++a+ +  g t+ qc +rw k
        PK06396.1 123 RDWTKDDDAKLRSAVEIFGESDWQSVASVLE-GWTGTQCSNRWKK 166
                      57*****************************.***********98 PP

3Myb_DNA-binding41.82.5e-13176219246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      grWT++Ed++lv a  ++G+++Wk+ a  ++ gRt+ qc++r+ +
        PK06396.1 176 GRWTADEDKRLVVAQLLFGPRNWKKTALFVP-GRTEVQCRERFVN 219
                      8******************************.**********976 PP

4Myb_DNA-binding49.69.2e-16229272348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +WT+eEd +l  a++++G   W+++a+ ++ +Rt+++c+ rw k+l
        PK06396.1 229 KWTAEEDAKLRAAIAEYGYC-WAKVAAAVP-RRTDNMCRRRWKKLL 272
                      8*****************99.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.9833863IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.6E-83876IPR009057Homeodomain-like
SuperFamilySSF466896.74E-1745112IPR009057Homeodomain-like
PROSITE profilePS500909.94264116IPR017877Myb-like domain
SMARTSM007172.1E-768118IPR001005SANT/Myb domain
CDDcd001671.47E-571116No hitNo description
PfamPF139214.1E-872120No hitNo description
Gene3DG3DSA:1.10.10.601.2E-1277128IPR009057Homeodomain-like
SuperFamilySSF466893.73E-1799172IPR009057Homeodomain-like
PROSITE profilePS5129417.379117172IPR017930Myb domain
SMARTSM007171.3E-11121170IPR001005SANT/Myb domain
PfamPF002496.2E-9123166IPR001005SANT/Myb domain
CDDcd001674.38E-9125168No hitNo description
Gene3DG3DSA:1.10.10.603.0E-13129171IPR009057Homeodomain-like
SMARTSM007171.8E-10174223IPR001005SANT/Myb domain
SuperFamilySSF466891.46E-23174268IPR009057Homeodomain-like
PROSITE profilePS512949.953174221IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-14176225IPR009057Homeodomain-like
PfamPF002491.4E-11176219IPR001005SANT/Myb domain
CDDcd001677.97E-9177221No hitNo description
PROSITE profilePS5129424.557222276IPR017930Myb domain
SMARTSM007171.3E-13226274IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-18226272IPR009057Homeodomain-like
CDDcd001671.47E-11229272No hitNo description
PfamPF002498.4E-15229272IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
XGNGEYHDVS NDLDNILASI KNLDITSENI RAFLPKVNWE YLASMHLVGR SGAECEARWL  60
NFEDPLINRN PWTAEEDKYL LLFVQEKGIS NWIDIAASLR TNRTPFQCLA RYQRSLNVSI  120
LKRDWTKDDD AKLRSAVEIF GESDWQSVAS VLEGWTGTQC SNRWKKSLHP TREKVGRWTA  180
DEDKRLVVAQ LLFGPRNWKK TALFVPGRTE VQCRERFVNS LDPSLNWDKW TAEEDAKLRA  240
AIAEYGYCWA KVAAAVPRRT DNMCRRRWKK LLPDEVPLLQ AARRIQKAAF IGNFVDRESE  300
RPALCPGDFG PLRLMANSEN TNQTNKQAGK LREVKKRNVK KSIENSQTDQ KEVLGISNVS  360
NHGEAETQGT QKSKPEAKKR KRCVKQQSKA TDLTEPNEER ECLLLQPEKL NPTNDGDWNE  420
PLGQADRFDP NEAITRQGSR KSNPETKKRR RSYKQHSKMT DLTEPNEELL QPEKLNPTSE  480
GDWTEPFDAN EAITRRNSQK SKPETKKRKE S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-27382764159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-27382764159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010097590.10.0Myb-like protein L
TrEMBLW9RFI80.0W9RFI8_9R
STRINGPOPTR_0015s04260.11e-148(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74413344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-131myb domain protein 4r1