PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK05727.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRF
Protein Properties Length: 627aa    MW: 66954.8 Da    PI: 8.4758
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK05727.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.52.7e-24246290145
        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  PK05727.1 246 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHINRGRHRSRKPVEG 290
                79****************************************985 PP

2QLQ52.51.5e-18177212237
        QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                +FT++Q+ +L++Q+l+yKy+ +n+ vP++Ll++++k
  PK05727.1 177 PFTPSQWIELEHQALIYKYITSNVAVPSNLLMPLKK 212
                9********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.6E-10176212IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088807.9E-13177210IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.286177212IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.287246290IPR014977WRC domain
PfamPF088798.1E-21247289IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    Send to blast
MDFGLVSLES LVGPPSHHEG GGGNGGGGGG GCGGGASSQF NDSDTKSINN GVLGSGFVKQ  60
ERSGPCDDDW KSSKVAKTVD LSSSKTMPLH QGSPMLRSNS LGFHADTRQQ EHMLSFSSNK  120
SQVSFLNKDA ALVERTSQNS AFPFYQRPPT SYSRNTGYGS GSLNAGMHAT FTGIRAPFTP  180
SQWIELEHQA LIYKYITSNV AVPSNLLMPL KKSLNPYGLA GSSAVSLPHN SLGWGSFHLG  240
FADNTDPEPG RCRRTDGKKW RCSRDAVADQ KYCERHINRG RHRSRKPVEG QTGQAASGTT  300
NSKVAQITTP VSTSVMPGGG GSASNNLAIT QHQFKGLQSG AAVATNPSTD TLVNRMQDLR  360
GAQSVMSSSN VNQKSNQTTF NVPKQVPAGG SSQSEFGLVS TDSLLNPSQE NAYINSKNYA  420
SFLDFSGQEA QDQHHPLRHF IDDWPKDQSN RSVITWPEEM KSDWTQLSMS IPVTSSEFSS  480
STNSPTRQEK LALSPLRLSR EFEPMQMNLG VNNDHFSEAT HKQTNWVPKS WGSSMGGPLG  540
EVLTNTAGSV KACKNPSSLN LLTEGWDGSP QLGSSPTGVL QKSTFCSLSN SSSGSSPRAD  600
NKRNIDGASV FDDVLGSTLA SSSVPSL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4886162e-48AM488616.1 Vitis vinifera contig VV78X030262.6, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015890409.10.0PREDICTED: growth-regulating factor 1 isoform X2
SwissprotO810011e-126GRF1_ARATH; Growth-regulating factor 1
TrEMBLW9S6210.0W9S621_9R
STRINGVIT_00s0494g00010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.11e-121growth-regulating factor 1