PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK05671.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 102aa    MW: 11122.6 Da    PI: 10.558
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK05671.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof129.59.6e-4142101261
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                ++++lkcprCds ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvPvGgg+rknkk+
  PK05671.1  42 EQQSLKCPRCDSPNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRNVPVGGGCRKNKKV 101
                57899*****************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2732100IPR003851Zinc finger, Dof-type
PfamPF027013.8E-3444100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.53446100IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
MMSADPAPAA APTKSASSKD EIHGTSAAGN RKNSSASRPA PEQQSLKCPR CDSPNTKFCY  60
YNNYSLTQPR HFCKTCRRYW TKGGALRNVP VGGGCRKNKK VK
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_029127523.18e-44dof zinc finger protein DOF5.7
SwissprotQ9LSL63e-36DOF57_ARATH; Dof zinc finger protein DOF5.7
TrEMBLA0A2P5AWK44e-52A0A2P5AWK4_PARAD; Zinc finger, Dof-type
TrEMBLA0A2P5FGY54e-52A0A2P5FGY5_TREOI; Zinc finger, Dof-type
STRINGXP_007158346.15e-42(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38543460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.16e-38Dof family protein
Publications ? help Back to Top
  1. Castorina G,Fox S,Tonelli C,Galbiati M,Conti L
    A novel role for STOMATAL CARPENTER 1 in stomata patterning.
    BMC Plant Biol., 2016. 16(1): p. 172
    [PMID:27484174]