PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK05260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family HD-ZIP
Protein Properties Length: 304aa    MW: 34823.5 Da    PI: 6.921
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK05260.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97.1e-1889142356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  PK05260.1  89 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 142
                456899***********************************************9 PP

2HD-ZIP_I/II129.11.8e-4188180193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrl+ eqvk+LE++Fe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy+ Lkr+++a+k++n+ L++++++L++e+++
    PK05260.1  88 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDLLKRQFEAIKADNDVLQAQNHKLQAEISA 180
                  69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.18E-1981146IPR009057Homeodomain-like
PROSITE profilePS5007117.32984144IPR001356Homeobox domain
SMARTSM003891.8E-1787148IPR001356Homeobox domain
CDDcd000869.49E-1589145No hitNo description
PfamPF000463.1E-1589142IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.2E-1991151IPR009057Homeodomain-like
PRINTSPR000311.2E-5115124IPR000047Helix-turn-helix motif
PROSITE patternPS000270119142IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5124140IPR000047Helix-turn-helix motif
PfamPF021835.0E-15144184IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MAFFPTNFML QTPSEEDQHH HHHHHHNPHH HPPTSLNQIN LPPCTPQEFH GVASFLGKRS  60
VSFSGIELGE EGNGGEDDLS DDGSQAGEKK RRLNMEQVKT LEKNFELGNK LEPERKMQLA  120
RALGLQPRQI AIWFQNRRAR WKTKQLEKDY DLLKRQFEAI KADNDVLQAQ NHKLQAEISA  180
LKNREPTESI NLNKETDQGS CSNRSENSSD IKLDISRTPA AIDSPLSSHP RALFPTSIRP  240
NSGHHVAQLF QTSSSARSSD QQLQYQKNDH HHHHVVKEES LSNMFCAIDD QSGFWPWLEH  300
QQFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136144RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022775796.11e-161homeobox-leucine zipper protein ATHB-13-like
SwissprotQ8LC031e-116ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A2P5AUL20.0A0A2P5AUL2_PARAD; Octamer-binding transcription factor
STRINGEOY020001e-156(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-106HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ribone PA,Capella M,Chan RL
    Functional characterization of the homeodomain leucine zipper I transcription factor AtHB13 reveals a crucial role in Arabidopsis development.
    J. Exp. Bot., 2015. 66(19): p. 5929-43
    [PMID:26136262]
  3. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  4. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]