PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK04548.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family LBD
Protein Properties Length: 184aa    MW: 20131.3 Da    PI: 7.0313
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK04548.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26058.51.9e-182810325100
     DUF260  25 eqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +q++++ +++k++G++ +++l++a p ++r+d+++sl+yeA+ r+ +P++G++g++++++++l+++++e++l++e+
  PK04548.1  28 SQSNATLFLAKFYGRAGLINLINAGPLHRRPDIFKSLLYEACGRIVNPISGSTGLVQSGSWHLCEAAVEAVLRGEP 103
                678999***************************************************************9988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.1562104IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-132897IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MDVEFSGEGA PRTVPSDLVF SGSNPXLSQS NATLFLAKFY GRAGLINLIN AGPLHRRPDI  60
FKSLLYEACG RIVNPISGST GLVQSGSWHL CEAAVEAVLR GEPIKPVSDE LVGNLSCDIR  120
HVAKRESSVL CDRLKVQTRQ RLRRKKVAKV EESETEFGTE SAHLVLSGPP VSHDSEEETR  180
LQQX
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1140149RLRRKKVAKV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015882967.15e-52PREDICTED: LOB domain-containing protein 40-like
SwissprotQ9ZW967e-45LBD40_ARATH; LOB domain-containing protein 40
TrEMBLA0A067KMA81e-48A0A067KMA8_JATCU; Uncharacterized protein
STRINGPGSC0003DMT4000329382e-45(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2539523
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67100.14e-46LOB domain-containing protein 40