PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK03929.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 355aa    MW: 37787.2 Da    PI: 9.5395
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK03929.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.91.1e-3848108262
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                +e+alkcprC+s+ntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+nkk+s
  PK03929.1  48 PETALKCPRCQSSNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKKTS 108
                67899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3532104IPR003851Zinc finger, Dof-type
PfamPF027012.1E-3251106IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.36652106IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105490IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
LPPPAQLIPS HHVGGGGSDS LSNGGTGTGS IRPGSMADRA RLAKIPQPET ALKCPRCQSS  60
NTKFCYFNNY SLTQPRHFCK TCRRYWTRGG ALRNVPVGGG CRRNKKTSKS SSRGSKSPAG  120
NNSGDQNKQT AAGSSSSTST GGGGLISPSA DPMSGHNNNN NNNTSSFLAS MQNLTRFGSG  180
NLGLNFTANN NNNNNDHHQI QAGGSDLGFQ IGSEVVDQWR LQQFPLMGGG HHDFESHPGN  240
NNLYPFQGSS GTSGMVEVGD NHDDHQMSHD HSNMMFRSRV SQLIPQVKVE DHRGNQLLVG  300
GGGLNLLRPN LGLSSSENNN YWGPSNGNTA SSTQWTDLST LNTTNINTST THPLL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2P5EJ951e-104A0A2P5EJ95_TREOI; Zinc finger, Dof-type
STRINGXP_010106451.13e-74(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.14e-44Dof family protein