PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK03565.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family SBP
Protein Properties Length: 508aa    MW: 56404.8 Da    PI: 7.084
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK03565.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.85.5e-42173248277
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                Cqv+gC++dls+ k+yh++hkvC+vhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCrrrLa+hnerrrk+q
  PK03565.1 173 CQVHGCNMDLSTSKDYHKKHKVCDVHSKTSKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRRRLAGHNERRRKPQ 248
                **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.1E-33167234IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.607170247IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.03E-39171251IPR004333Transcription factor, SBP-box
PfamPF031101.9E-31173246IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 508 aa     Download sequence    Send to blast
MESWNFAAEG KALLFSDDID WSDAFSRNRK ALIQCENGLV PGRESVESLE YMELGFPEML  60
RKTIQNSQGL EMLCGGGGEV GNGSIHRAAS PACLISPNSS LVEDESGSNS KVSSSFMESN  120
SQDSPLIALK LGRFGDCRNS QNNEHSKDKT VSSPSLVVKR ARVRGSYSQT PFCQVHGCNM  180
DLSTSKDYHK KHKVCDVHSK TSKVIVNGIE QRFCQQCSRF HLLAEFDDGK RSCRRRLAGH  240
NERRRKPQLD GLSDKPHKFS NAYQGTRYLG ASLQKRTPFV FSDILPGVIL SPEKYEQANQ  300
FGHIKFEEEP IYSPQLTAPV KSTQMFSKSL IHPHSSGVPS LENDDYSFHT AATIHKPYGA  360
SNSACALSLL SVQSHNFSSH SAGIPNESPM IIPGAHQTAG QLSEKPLRLR SMERHGQNGF  420
YSCGTNSMGV DQFESAVFTE SNHAADFEAA DRSSRNSDCF DTKYSLSPEH ESTVDLLQLS  480
SHLQRVEHQR NFIPVKQENE DFCCFQTA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-291722461084squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015895206.10.0squamosa promoter-binding-like protein 6
TrEMBLA0A2P5FHG10.0A0A2P5FHG1_TREOI; SBP-box transcription factor
STRINGXP_010091609.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-48SBP family protein