PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK03488.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 252aa    MW: 28866.8 Da    PI: 4.7632
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK03488.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.2e-18552148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+++v+++G  +W++ ++  g+ R++k+c++rw +yl
        PK03488.1  5 KGPWTPEEDQILINYVQKFGHANWRALPKQAGLLRCGKSCRLRWINYL 52
                     79******************************99************97 PP

2Myb_DNA-binding54.52.7e-1758103148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
        PK03488.1  58 RGNFTAEEEQTIINLHQMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 103
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.844156IPR017930Myb domain
SuperFamilySSF466897.05E-32199IPR009057Homeodomain-like
SMARTSM007172.4E-14454IPR001005SANT/Myb domain
PfamPF002499.4E-17552IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-26659IPR009057Homeodomain-like
CDDcd001671.33E-10752No hitNo description
PROSITE profilePS5129420.44757107IPR017930Myb domain
SMARTSM007177.4E-1557105IPR001005SANT/Myb domain
PfamPF002494.3E-1658103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-2760107IPR009057Homeodomain-like
CDDcd001674.62E-1060103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGLKKGPWTP EEDQILINYV QKFGHANWRA LPKQAGLLRC GKSCRLRWIN YLRPDIKRGN  60
FTAEEEQTII NLHQMLGNRW SAIAARLPGR TDNEIKNVWH THLKKRLLNN NNSNNLSSSS  120
SKRQRIDDND QHPISTTTSC SSSDSDFSSV TAELLHQNDN KEIVVIKDEE EEEEDNSNNQ  180
VSSSSARSCT NIIIDDESMI WPLDQVVSSF DGHDHHDDES LLFVNNGNDE YDMEFWYDIF  240
IKAGGSTELP EF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-2931075108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003518022.14e-83PREDICTED: myb-related protein Myb4-like
TrEMBLI1JB855e-83I1JB85_SOYBN; Uncharacterized protein
STRINGGLYMA02G00820.11e-82(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.11e-68myb domain protein 14