PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK02601.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family ARR-B
Protein Properties Length: 675aa    MW: 74533.6 Da    PI: 6.5089
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK02601.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.33.5e-28196249155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                kpr++W+ eLH++Fv av++L G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  PK02601.1 196 KPRVVWSVELHRKFVTAVNHL-GIDKAVPKKILDLMNVDKLTRENVASHLQKYRL 249
                79*******************.********************************8 PP

2Response_reg80.84.5e-27161241109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+pl ++ll+ +l++ +y +v++ +++ +al++l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++++g+++++ + +  Ga 
     PK02601.1  16 VLAVDDDPLCLRLLEALLRRCQY-HVTTSSEAVAALNMLRENRnnFDLVISDVQMPDMDGFKLLELVGL-EMDLPVIMLSGNGDPKLVMKGITHGAC 110
                   799********************.***************999889*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel +
     PK02601.1 111 DYLLKPVRIEELKN 124
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.2E-1591669IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23002.9E-4213148No hitNo description
SuperFamilySSF521723.42E-3613137IPR011006CheY-like superfamily
SMARTSM004487.5E-3314126IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.5615130IPR001789Signal transduction response regulator, receiver domain
PfamPF000726.4E-2416124IPR001789Signal transduction response regulator, receiver domain
CDDcd001566.61E-2417130No hitNo description
Gene3DG3DSA:1.10.10.606.1E-30193254IPR009057Homeodomain-like
PROSITE profilePS5129412.39193252IPR017930Myb domain
SuperFamilySSF466891.0E-19194253IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-25196249IPR006447Myb domain, plants
PfamPF002493.0E-6198248IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 675 aa     Download sequence    Send to blast
MTVDDPRDQF PIGMRVLAVD DDPLCLRLLE ALLRRCQYHV TTSSEAVAAL NMLRENRNNF  60
DLVISDVQMP DMDGFKLLEL VGLEMDLPVI MLSGNGDPKL VMKGITHGAC DYLLKPVRIE  120
ELKNIWQHVI RRKKKDTKSQ RNCSNQDKSN VEGESGCGGT GNSDQKINKK RKDQFDDDED  180
ENDDNGDSDD PSAQKKPRVV WSVELHRKFV TAVNHLGIDK AVPKKILDLM NVDKLTRENV  240
ASHLQKYRLY LKRISCHANQ HANMEAALRS SDSSYLRMGS MNGLGNFNAL NGSMQFQNPA  300
FRSFPPGGIV GRLNTPSAMG LRGLPSSGMV QLSHTQNPNS SHDQMKFHQS TLPAGNHDGN  360
VLHGMPMPFE INQQHIKGVP HIGDLSTGLD DSTLFPLSDA KLTTSNNSSN ALGVANNMMM  420
LGHSHDPQGG REFGNQSSVS LTSLKSEFCP PLPDPGRCTT DWSSSAQTSG FQSTSFPLND  480
RYKQATMHPG ISRDNNMPIM APQIGGSQFD VSSFPSVSIR SHDSLTDAQC QTSAMNNGAL  540
IPSWDNHKHD PSYRPNIMSS SMNSLMPVNG GAGGPLDQSL DLKNQIYHRN TDFNSLGQTN  600
YVDPLIAKYE EVEKSTMETL KFKHEYLMSQ QRSHGGYNMS TNYGPLGDVV SAIMKQEQDG  660
RVEGDFDAYS LGTSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-28192255164ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130135RRKKKD
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the root-meristem size determination through the regulation of cell differentiation (PubMed:17363254). Involved in activating SHY2 during meristem growth and controls PIN expression via activation of SHY2 (PubMed:20605455). {ECO:0000250|UniProtKB:Q940D0, ECO:0000269|PubMed:17363254, ECO:0000269|PubMed:20605455}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010089952.10.0two-component response regulator ARR12 isoform X1
SwissprotB8AEH11e-135ORR23_ORYSI; Two-component response regulator ORR23
SwissprotP625981e-135ARR12_ARATH; Two-component response regulator ARR12
SwissprotQ6K8X61e-135ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A2P5FN530.0A0A2P5FN53_TREOI; Two-component response regulator
STRINGXP_010089952.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-127response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  3. Cortleven A, et al.
    A novel protective function for cytokinin in the light stress response is mediated by the Arabidopsis histidine kinase2 and Arabidopsis histidine kinase3 receptors.
    Plant Physiol., 2014. 164(3): p. 1470-83
    [PMID:24424319]
  4. Kim HJ,Kieber JJ,Schaller GE
    The rice F-box protein KISS ME DEADLY2 functions as a negative regulator of cytokinin signalling.
    Plant Signal Behav, 2013. 8(12): p. e26434
    [PMID:24675172]
  5. Choi SH, et al.
    Gene duplication of type-B ARR transcription factors systematically extends transcriptional regulatory structures in Arabidopsis.
    Sci Rep, 2014. 4: p. 7197
    [PMID:25425016]
  6. Jiang L, et al.
    Strigolactones spatially influence lateral root development through the cytokinin signaling network.
    J. Exp. Bot., 2016. 67(1): p. 379-89
    [PMID:26519957]
  7. Cortleven A, et al.
    Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes.
    Plant Physiol., 2016. 172(1): p. 464-78
    [PMID:27388681]
  8. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  9. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  10. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  11. Kobayashi K,Iwase A
    Simultaneous but spatially different regulation of non-photosynthetic callus formation and photosynthetic root development after shoot removal.
    Plant Signal Behav, 2017. 12(6): p. e1338999
    [PMID:28594268]
  12. Dai X, et al.
    ARR12 promotes de novo shoot regeneration in Arabidopsis thaliana via activation of WUSCHEL expression.
    J Integr Plant Biol, 2017. 59(10): p. 747-758
    [PMID:28681564]
  13. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  14. Yan Z, et al.
    Type B Response Regulators Act As Central Integrators in Transcriptional Control of the Auxin Biosynthesis Enzyme TAA1.
    Plant Physiol., 2017. 175(3): p. 1438-1454
    [PMID:28931628]
  15. Bustillo-AvendaƱo E, et al.
    Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis.
    Plant Physiol., 2018. 176(2): p. 1709-1727
    [PMID:29233938]