PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK02496.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family HB-other
Protein Properties Length: 1029aa    MW: 115114 Da    PI: 8.7472
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK02496.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox15.33.4e-0569125157
                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                +r+R  ++++ ++ ++++F  +  +s++e +e+ +  g+t +qV+ +F  +R + ++
  PK02496.1  69 KRPRDLLNPKAVKYMQSVFSVKDAVSKKECREICALYGVTVTQVREFFASQRSRVRR 125
                799**************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500718.95666126IPR001356Homeobox domain
SMARTSM003890.001668130IPR001356Homeobox domain
SuperFamilySSF466891.8E-668129IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-569137IPR009057Homeodomain-like
Gene3DG3DSA:1.20.930.101.5E-6225316IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476768.63E-6228314IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1029 aa     Download sequence    Send to blast
MNALKEDFLE IQIGTSADSL AKSLDSQREL FHSQVDQLQR IVVTQCKLTG ANPLSQEMAA  60
GALSIQIGKR PRDLLNPKAV KYMQSVFSVK DAVSKKECRE ICALYGVTVT QVREFFASQR  120
SRVRRLVRLS REKATKSNSC AELNDGVHAI SDPLLPFQPI PLNTIAPTGI EETPSCSTED  180
DVLPGIDGLD KQFVENIFSW MRKEETYSGQ VKLMEWILQM KNSAVLCWFL SKGGMMIIAS  240
WLSQAAEEEQ TSILLVILNV LCHLPLHKAL PAHMSAILQS VNRLRFYRTS DISNRARVLL  300
SKWSKLLARS EALKKPNGLK SSVDAQQQMM LKQSLSDVMG DDSWQSSIDT PENLLDSSEN  360
VRKFEQSVKL LPASSDDPNK KHILGLSSSQ FRERRKVQLV EQPGNRAAGR SPQTTRAAPL  420
NQERPMSADD IQKAKMRAQY LQSKYVKANS SHENKEAKTE GLNKPSTSQV SNVPTASKVV  480
VRPDIDEHKK PTITPLKVPN TLEASLESKP IIDLKESVWE KCKRVQILWK TPPEVKLDHQ  540
WRVGAGDNSK EAEFQRNRNR REKETFYQTN QEIPLNPKEP WDQEMDYDDS LTLEIPIEQM  600
PEPNGGSNAE ALVSPKHDVD SAITQILDSQ RANGSVPLAA PETSQSGNAS TAEPDLELLA  660
VLLKNPELVF ALTSGQAANL SSEETVKLLD MIKAGNTSSN NGINRKVEEK VEVSLPSPTP  720
STNPGTSGWR PEGVRNPFSR ATLPKGVGES PPPLAMATAN SVLPSHMLAP HNLPVISSYS  780
LSQVTSTVHE KYSTSIGSSL HHQLPLTSSP IVHTHLPQVT GPMYNLHSQD LSSLRHESTT  840
NTKSQASMSN NMYNVEERRH HSFPTPLLPA APSSRPMLQH MHMQQQQQHY QPQHQQQHYQ  900
PQQHYAEPSP SPSPSAPIYS KQIGKLSNVP DSWRPRQNLP SNYNPTVNQN NSNYHRGSYG  960
EEDEFESWSP DNSPSRNSEY SGLGRSFPEP RMDPGRGYWP TDQSRVRSSP GYRDSNRHGN  1020
KRWRDQRRR
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024017708.10.0homeobox protein LUMINIDEPENDENS
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A2P5FFR50.0A0A2P5FFR5_TREOI; Octamer-binding transcription factor
STRINGEOX949880.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]