PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK01704.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 980aa    MW: 110345 Da    PI: 5.0574
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK01704.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.8e-14853248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
        PK01704.1  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                     78*****************************.************986 PP

2Myb_DNA-binding32.81.6e-1060103248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
        PK01704.1  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                      68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
PfamPF139214.5E-131070No hitNo description
CDDcd001679.14E-121053No hitNo description
SuperFamilySSF466898.27E-2133106IPR009057Homeodomain-like
CDDcd116591.97E-3055106No hitNo description
Gene3DG3DSA:1.10.10.603.2E-1457104IPR009057Homeodomain-like
PROSITE profilePS5129416.44358107IPR017930Myb domain
SMARTSM007171.7E-1258105IPR001005SANT/Myb domain
PfamPF118314.2E-53407657IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 980 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDAACVKD DNYEPGDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDTRQR KRKRKGIDYN AEIPFEKKPP PGFYDVTDEE RTVEQPSFPT  240
TIEELEGKRR IDVEAQLRKQ DIAKNKIAER QDAPSAILQA NKLNDPEAVR KRSKLMLPAP  300
QISDHELEEI AKIGYASDLL AGGEDLTDGN GATRALLANY GQTPRQGVTP LRTPQRTPAG  360
KGDAIMMEAE NLARLRESQT PLLGGENPEL HPSDFSGVTP KKKEIQTPNP MLTPSATPGA  420
AGLTPRIGMT PTRDGYSFGM TPKGTPIRDE LRINEEMEIH DSRKVELRRQ ADMRRNLISG  480
FSNLSQPKNE YQVVVQPGPD ENEEPEQNIE EDMSDRLARE KAAEEARLQA LLRKRSKVLQ  540
RELPRPPAAS LELIKNSLMR ADGDKSSFVP PTVIEQADEM IRRELLTLLE HDNAKYPLNE  600
KVNKEKKKGA KRSANGSVAP IPEIEDFEEY ELKEADNFIK EEAGYLRLAM GHEGESLDQF  660
VDAHNTCLND LMYFPTRNAY GLSSVAGNME KLAALQNEYE NVRKNVEDDI KKATNLEKKT  720
KILTDGYELR AKKSLWPQIE ETFKQMDTAA KELECFQALQ KQEQLAASHR INNIWEEVKK  780
QKELERTLQK RYGDLLGELE RTRHQMDEYR VQAQKQEEIA ANNCDTELAE SAANQSVAQS  840
TEDSVLTVAS DELVSAMSID PSRDENAGQQ TKSIEEHAQS PTAHDEINPA EGNGYDGSNI  900
QLSSTNGTGD GMSEVVAEEK EVPQNSVDEV ANDDMTTDEI AMNVKNHQNA TIHESSIREN  960
AGNDGPIGDA KEVSGNGEEK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10232242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDTRQRKRKRK
2199204RKRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010102234.10.0Cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLW9RI030.0W9RI03_9R
STRINGGLYMA20G36600.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40723354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5