PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK01174.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 317aa    MW: 34630.1 Da    PI: 9.2556
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK01174.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l  ++kq+G g W+  +++ g+ R++k+c++rw +yl
        PK01174.1 14 KGAWTAEEDQILFSYIKQHGEGGWRHLPQKAGLSRCGKSCRLRWANYL 61
                     79********************************************97 PP

2Myb_DNA-binding46.58.4e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +++eE++ ++++++ lG++ W+ I+r++  +Rt++++k++w++
        PK01174.1  67 RGEFSPEEEQTIIRLHAILGNK-WSIISRHLY-RRTDNEVKNYWNT 110
                      899*******************.********9.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.7E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.08961IPR017930Myb domain
SuperFamilySSF466891.98E-2811108IPR009057Homeodomain-like
SMARTSM007178.9E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-141461IPR001005SANT/Myb domain
CDDcd001673.24E-101661No hitNo description
PROSITE profilePS5129423.61662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2365115IPR009057Homeodomain-like
SMARTSM007179.5E-1466114IPR001005SANT/Myb domain
PfamPF002492.9E-1367110IPR001005SANT/Myb domain
CDDcd001675.83E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MGRTPCCDQK GLRKGAWTAE EDQILFSYIK QHGEGGWRHL PQKAGLSRCG KSCRLRWANY  60
LRPGIKRGEF SPEEEQTIIR LHAILGNKWS IISRHLYRRT DNEVKNYWNT RLKKRATTEI  120
NSKDSPVRHK TNDDDSSDNG NIIINSTAIS EENIINNYSN SDNVTKEAST SSPSSSSSTT  180
DYVLNRGLQN LMSPISITTT TTTNSKGLAT ISTSLDTEIS SNSLQMNKGI STDTASSSVS  240
TSIKACGDDH LNVSRTTSST ASASSRALLN KIASKLNQIN RGTIIGMGSG CSGGARDGVE  300
HRTMDYSSPN FCCTPSX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-23121185110B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9FLR12e-64MYB29_ARATH; Transcription factor MYB29
STRINGAT5G07690.15e-62(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3190922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07690.11e-62myb domain protein 29