PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK01144.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 246aa    MW: 25606.4 Da    PI: 8.2102
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK01144.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.52.9e-382684361
     zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                + l+cprCds ntkfCyynny+l qPr+fCk+CrryWt+GGalr++PvGgg+rkn k+
  PK01144.1 26 PEPLPCPRCDSINTKFCYYNNYNLLQPRHFCKGCRRYWTHGGALRDIPVGGGTRKNTKR 84
               57899***************************************************886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.4E-322883IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8452983IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103167IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-213384IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MPSESGDKKQ AARPQLSMGH LPPAHPEPLP CPRCDSINTK FCYYNNYNLL QPRHFCKGCR  60
RYWTHGGALR DIPVGGGTRK NTKRTRSSNS NSSSSSSSSS SMTHDHQLLP SKPLLPDFSL  120
VNTQTDSSAV SQAQVNLNNG SVAGGVGFTS LLNCQAPGGF LALGGFGLGV DEIGLGYGYG  180
GRGVWAFPEV GEFVNGGGGT AVGPGSTSGC NAWQQMNGSD GGLVDGGGDC SYWPDLAISM  240
SGKGLK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008220719.15e-69PREDICTED: dof zinc finger protein DOF3.4
TrEMBLA0A2P5D9Z54e-73A0A2P5D9Z5_PARAD; Zinc finger, Dof-type
STRINGXP_008220719.12e-68(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28013168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.14e-30OBF binding protein 1