PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK00254.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 291aa    MW: 30503.8 Da    PI: 9.9466
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK00254.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.76.1e-3989148362
     zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                e+alkcprC+s+ntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+++
  PK00254.1  89 ETALKCPRCESANTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRTK 148
                7789*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3376146IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3291146IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.49792146IPR003851Zinc finger, Dof-type
PROSITE patternPS01361094130IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MVFSSLPAYH DPANWQQQPN HPNIIPSSSS AGMSSGSHQL LPPPAAPTSL PLPPPPPPLQ  60
PHGGGGGAGS IRPGSMADRA RMANIPMPET ALKCPRCESA NTKFCYFNNY SLSQPRHFCK  120
TCRRYWTRGG ALRNVPVGGG CRRNKRTKGS SGGGGGSSKS PVSSSDNNRH TGGSMTTSGS  180
SGAVPSGNND ILGLAHQVPP GLRFMTPLHH QLTHHHDFVA AASSDHNLGF NYGGLNYGAM  240
SAPMGGGADL NFHIGSSALS GPSNNSLLTG FEQWRMQQPP QFPFLASGLD X
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00295DAPTransfer from AT2G37590Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018831327.19e-93PREDICTED: dof zinc finger protein DOF5.1-like
TrEMBLA0A2P5APR81e-109A0A2P5APR8_PARAD; Zinc finger, Dof-type
STRINGGorai.006G173700.16e-88(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.14e-46DNA binding with one finger 2.4