PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10028378m
Common NameCARUB_v10028378mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 259aa    MW: 30577.7 Da    PI: 9.3023
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10028378mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF61.97.4e-209441651
                     HHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF 16 RrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        +i+KKA+ELSvLC++ev+vi+++++g+l+++++
  Carubv10028378m  9 SSRTIFKKAYELSVLCAIEVCVIYYGPDGQLKTWPK 44
                     5679******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006610.204646IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-15978IPR002100Transcription factor, MADS-box
PfamPF003199.8E-121142IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MFHPQFHNSS RTIFKKAYEL SVLCAIEVCV IYYGPDGQLK TWPKEKEKVK DIALRYKEAR  60
KRKKSLNLHE FLEKEKDKDK DKVTTNLKKK NVKYPHWYPK FDHYSPQQLS QLIQSLERTL  120
SKLQERLRVV EAKKQRNNTN LVHPNQHLNP ENFSLYMYNH DDAILSQPPF NASHANLLSN  180
YQNHLMKQEL YDFGQNMCMD NITNTNFHHP CYSNTQGYAP LLSQKELNGF DQNMVLMSNI  240
TNNNGLSNTV PHEFYPNEL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15963RKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction. {ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10028378m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0114792e-74AB011479.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MNA5.
GenBankAY1412242e-74AY141224.1 Arabidopsis thaliana MADS-box protein AGL78 mRNA, complete cds.
GenBankCP0026882e-74CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023633447.11e-172LOW QUALITY PROTEIN: agamous-like MADS-box protein AGL75
SwissprotQ9FLL04e-63AGL75_ARATH; Agamous-like MADS-box protein AGL75
TrEMBLR0GEA30.0R0GEA3_9BRAS; Uncharacterized protein (Fragment)
STRINGXP_006282126.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56620126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65330.16e-95AGAMOUS-like 78
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]