PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10027979m
Common NameCARUB_v10027979mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 287aa    MW: 33093.8 Da    PI: 8.6227
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10027979mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.62.5e-161052244
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                     ri n+  r +t+ kR++ + KKA E S+LC+++ ++i++++t 
  Carubv10027979m 10 RIANDKTRITTYKKRKANLYKKAAEFSTLCGVKTCLIVYGPTK 52
                     89**************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd002661.48E-24181No hitNo description
SMARTSM004325.3E-13160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.18161IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-7323IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.67E-17686IPR002100Transcription factor, MADS-box
PfamPF003198.3E-161052IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MTQKIVNLQR IANDKTRITT YKKRKANLYK KAAEFSTLCG VKTCLIVYGP TKATDEVVSE  60
PEIWPRDETE VRDIIRKYKD SVSNTCKKET HVETFVNDLG KAKDMGTTNK RVPRSSENKY  120
CSWEQKLDKC SREQLCGIFC AVDNKLHEAA MRQERSMFMA HHQAMDTPIQ QSLMEQHYMQ  180
QYLPEQPQFQ GFPNNYNNMG FSFIPPHDDQ IQMDPILMEN LTSLGLNQGL MMSKGNDVTQ  240
LMQRQAQPYY NREPVVQRPA AYNVNPFAGY QVPFNIPWDL SGKKTI*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction. {ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10027979m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006281804.10.0agamous-like MADS-box protein AGL82
SwissprotQ9FIM01e-159AGL82_ARATH; Agamous-like MADS-box protein AGL82
TrEMBLR0EZF40.0R0EZF4_9BRAS; Uncharacterized protein
STRINGXP_006281804.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59481947
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.11e-161AGAMOUS-like 82
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]