PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10027849m
Common NameCARUB_v10027849mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 197aa    MW: 22718.9 Da    PI: 10.8553
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10027849mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.61.7e-1077138162
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      +k+++r +rk +NR +A+rsR +K++ +e  + k  +L+ eN++Lk++l     ++++ k+e
  Carubv10027849m  77 DKDDRRKKRKLSNRKSAQRSRIKKQKHLEDVRSKLNQLKFENRELKNRLRYVLYHCERAKME 138
                      6899*******************************************999988888888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.4E-972131No hitNo description
SMARTSM003385.7E-1077141IPR004827Basic-leucine zipper domain
PfamPF001701.5E-778138IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.23179125IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.77E-881129No hitNo description
PROSITE patternPS0003608499IPR004827Basic-leucine zipper domain
CDDcd147027.61E-1187126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MSEPVLSNHV PALETGFTPW DDASDLFSIF NSPVRPMEVN PGLDKINPTQ IQNQRYSSPG  60
FKDKPLKHTG SSGVSSDKDD RRKKRKLSNR KSAQRSRIKK QKHLEDVRSK LNQLKFENRE  120
LKNRLRYVLY HCERAKMESD GLRLEHRALH EKLLSLRQAL VMRQIQQNST CATWSSVNTT  180
VVTVQRNPSM MRDHVI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17986DRRKKRKL
280101RRKKRKLSNRKSAQRSRIKKQK
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10027849m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006281700.11e-145ocs element-binding factor 1
TrEMBLR0GTW01e-144R0GTW0_9BRAS; Uncharacterized protein
STRINGXP_006281700.11e-144(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33382665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.12e-36basic leucine-zipper 5