PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10027656m
Common NameCARUB_v10027656mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 357aa    MW: 40091.3 Da    PI: 10.0783
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10027656mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.13.9e-13280331455
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      +k+ +rk+kNRe+A rsR+RK+a++ eLe + ++L+++ ++L k+   l+k+
  Carubv10027656m 280 DKKLKRKIKNRESAARSRARKQAQTMELEAELEKLKKQYEELLKQQVDLRKM 331
                      699*************************************999887777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.5E-9277341IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.358279330IPR004827Basic-leucine zipper domain
PfamPF001702.6E-9280331IPR004827Basic-leucine zipper domain
CDDcd147072.90E-18281335No hitNo description
SuperFamilySSF579591.03E-9281331No hitNo description
Gene3DG3DSA:1.20.5.1705.6E-11281330No hitNo description
PROSITE patternPS000360284299IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MDSYWRLKNL VNDLPVTNPS SRQGSSIYSW TVDQFQTSLG KNCGSMNMDE LVKNICSAEE  60
TQGALQRQGS TSLPRTLSHK TVDEVWKYIT QEEETKNYGV TNISHLQRQQ TLGEITLEEF  120
LIRSGARINN TSNVSIHDSS SLISGYPNTS LDVEFQPNAM VPMSHESNLH QNVNVSTMSA  180
YQPQQPIMSR PNGYSYGQQI RSSNGVQGNK RSLVPSVAKN PSGTMACSSV KPFPILNKTR  240
KIDGESSLLS SSPYIFSGNT STRGRKIDIN AITAENKLVD KKLKRKIKNR ESAARSRARK  300
QAQTMELEAE LEKLKKQYEE LLKQQVDLRK MLIEPGMINR QGEPERKLRR TKSDIM*
Functional Description ? help Back to Top
Source Description
UniProtCould participate in abscisic acid-regulated gene expression. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10027656m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006281554.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 8
SwissprotQ9FMM71e-163AI5L8_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 8
TrEMBLR0EYV10.0R0EYV1_9BRAS; Uncharacterized protein
STRINGXP_006281554.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM156311417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42910.11e-128bZIP family protein