PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10027647m
Common NameCARUB_v10027647mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 308aa    MW: 34139.2 Da    PI: 5.3324
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10027647mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.21.3e-16226283461
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                       +r+rr++kNRe+A rsR+RK+a++ eLe+ +++Le+eN+ L ke+ee +ke ++  +
  Carubv10027647m 226 AQRQRRMIKNRESAARSRERKQAYQVELETLAAKLEEENELLSKEIEEKRKERYQKLM 283
                      79**********************************************9999987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.2E-13222278No hitNo description
SMARTSM003384.4E-12223287IPR004827Basic-leucine zipper domain
PfamPF001701.1E-15225284IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.289225277IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.19E-10227279No hitNo description
CDDcd147075.05E-18227273No hitNo description
PROSITE patternPS000360230245IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MTSFQVMRSS NSRNSDLSHR ISSSSSSSSI RPHQQQFRRD LSNGGYGVRN DGLLYSSTSM  60
TVEGILHDTF ASDPPAPTES SLLDASITLM DASPATMTVV VEGGTETTTT TRDGKSVDEV  120
WREMVSGEGK GMKEETQEEI MTLEDFLAKA AVGDEAGAAD DLDVKISPTN YGFDHSAPPH  180
NPFQMIDKVE GSIVAFGNGL DVYGGGGGAR GKRARVMVEP LDKVAAQRQR RMIKNRESAA  240
RSRERKQAYQ VELETLAAKL EEENELLSKE IEEKRKERYQ KLMEFVIPVV EKPQQQRFLR  300
RIRSLEW*
Functional Description ? help Back to Top
Source Description
UniProtBinds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. {ECO:0000269|PubMed:8146148}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10027647m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0864570.0AY086457.1 Arabidopsis thaliana clone 25211 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006281546.10.0G-box-binding factor 4
SwissprotP427773e-70GBF4_ARATH; G-box-binding factor 4
TrEMBLR0GCP80.0R0GCP8_9BRAS; Uncharacterized protein
STRINGXP_006281546.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38522855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.11e-128bZIP family protein