PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10027564m
Common NameCARUB_v10027564mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 278aa    MW: 31680.7 Da    PI: 5.9267
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10027564mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.62.5e-161051243
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                     +i+n+  r +t+ kR++ + KKA+E S+LC+++ ++i+++++
  Carubv10027564m 10 KIQNEKTRITTYKKRKACLYKKASEFSTLCGVDTCLIVYGPS 51
                     79**************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.385161IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-14160IPR002100Transcription factor, MADS-box
CDDcd002663.93E-27280No hitNo description
SuperFamilySSF554558.63E-202100IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-7323IPR002100Transcription factor, MADS-box
PfamPF003196.5E-171051IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MGRKMVKMEK IQNEKTRITT YKKRKACLYK KASEFSTLCG VDTCLIVYGP SRAGDEMVAE  60
PELWPKDESK VREIITKYRD IASSSCTKTY TVQECLEKNN TKEEKSKNET KYSPWDKKLD  120
KCSLNELYAV FMAVENKIQE ATNRNQTFPD TTSWSNEQLG LCGYNQQCLE QYQLFPLPTM  180
EHNGFSFFPL NNQITSNTAE VASFSCATEP MIANGQTFFY GSCSDGSCAP VLQRTAYVEP  240
IQWGLGNSMF NDVKQFQDYH FKFAQVNDSE DSSKQPM*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10027564m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0090500.0AB009050.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MDF20.
GenBankAY1412140.0AY141214.1 Arabidopsis thaliana MADS-box protein AGL47 mRNA, complete cds.
GenBankBT0260420.0BT026042.1 Arabidopsis thaliana At5g55690 mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006281480.10.0agamous-like MADS-box protein AGL82
TrEMBLR0GT530.0R0GT53_9BRAS; Uncharacterized protein
STRINGXP_006281480.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59481947
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-171M-type_MADS family protein