PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10026623m
Common NameCARUB_v10026623mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 369aa    MW: 41979.6 Da    PI: 7.457
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10026623mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.52.2e-1182118339
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLe 39 
                      ++k +rr+++NReAAr+sR+RKka++++Le+   +L 
  Carubv10026623m  82 PDKIQRRLAQNREAARKSRLRKKAYVQQLETSRLKLI 118
                      6899**************************8655554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.9E-680143IPR004827Basic-leucine zipper domain
PfamPF001702.1E-882113IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.77282124IPR004827Basic-leucine zipper domain
CDDcd147088.54E-2384135No hitNo description
SuperFamilySSF579592.56E-784119No hitNo description
Gene3DG3DSA:1.20.5.1701.9E-786112No hitNo description
PROSITE patternPS00036087102IPR004827Basic-leucine zipper domain
PfamPF141444.3E-28170245IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042742Biological Processdefense response to bacterium
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MNSTSTHFVP PRRVGIYEPV HQFGMWGDSF KSNIGNGNMN TPTHIIIPNN QKLDNNLSED  60
TSHGTAGTPH MFDQEASTSR HPDKIQRRLA QNREAARKSR LRKKAYVQQL ETSRLKLIQL  120
EQELDRARQQ GFYVGNGIET NSLGFSETMN PGIAAFEMEY GHWVEEQNRQ ICELRTVLHG  180
HINDVELCLL VETAMKHYFE LFKMKSTAAK ADVFFVMSGM WKTSAERFFL WIGGFRPSDL  240
LKVLLPHFDI LTDQQILDVC NLRQSCQQAE DALTQGMEKL QHTLADCVAG GQLGEGSYIP  300
QVNSAMDRLE ALVSFVNQAD HLRHETLQQM YRILTTRQAA RGLLALGEYF QRLRALSSSW  360
ATRHREPT*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00586DAPTransfer from AT5G65210Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10026623m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3171420.0AK317142.1 Arabidopsis thaliana AT5G65210 mRNA, complete cds, clone: RAFL21-72-M22.
GenBankAK3174880.0AK317488.1 Arabidopsis thaliana AT5G65210 mRNA, complete cds, clone: RAFL23-11-L19.
GenBankAY0870490.0AY087049.1 Arabidopsis thaliana clone 31032 mRNA, complete sequence.
GenBankAY0995930.0AY099593.1 Arabidopsis thaliana DNA binding protein TGA1a-like protein (At5g65210) mRNA, complete cds.
GenBankAY1288380.0AY128838.1 Arabidopsis thaliana DNA binding protein TGA1a-like protein (At5g65210) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006280664.10.0transcription factor TGA1
SwissprotQ392370.0TGA1_ARATH; Transcription factor TGA1
TrEMBLR0EWJ40.0R0EWJ4_9BRAS; Uncharacterized protein
STRINGCagra.0917s0063.1.p0.0(Capsella grandiflora)
STRINGXP_006280664.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29762766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65210.50.0bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Herrera-Vásquez A, et al.
    Transcriptional Control of Glutaredoxin GRXC9 Expression by a Salicylic Acid-Dependent and NPR1-Independent Pathway in Arabidopsis.
    Plant Mol. Biol. Rep., 2018.
    [PMID:26696694]
  4. Gutsche N,Zachgo S
    The N-Terminus of the Floral Arabidopsis TGA Transcription Factor PERIANTHIA Mediates Redox-Sensitive DNA-Binding.
    PLoS ONE, 2016. 11(4): p. e0153810
    [PMID:27128442]
  5. Sun T, et al.
    TGACG-BINDING FACTOR 1 (TGA1) and TGA4 regulate salicylic acid and pipecolic acid biosynthesis by modulating the expression of SYSTEMIC ACQUIRED RESISTANCE DEFICIENT 1 (SARD1) and CALMODULIN-BINDING PROTEIN 60g (CBP60g).
    New Phytol., 2018. 217(1): p. 344-354
    [PMID:28898429]