PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10026317m
Common NameCARUB_v10026317mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family HRT-like
Protein Properties Length: 482aa    MW: 54528.1 Da    PI: 9.2236
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10026317mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like57.62.1e-18278308131
         HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                      +CGvile+G +C+r+PvkgRKRC eHKG+R+
  Carubv10026317m 278 VCGVILENGGFCNRSPVKGRKRCIEHKGQRV 308
                      7*****************************7 PP

2HRT-like45.21.5e-14340369231
         HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                      CGvil d   C++ +v+gRKRCe HKGmRi
  Carubv10026317m 340 CGVILPDMESCSKRAVQGRKRCEDHKGMRI 369
                      *****************************7 PP

3HRT-like30.65.6e-10411437228
         HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKG 28 
                      C ++++ G +C+r+P kg KRC++HK 
  Carubv10026317m 411 CEATTKKGLPCTRSPPKGSKRCWQHKE 437
                      999***********************7 PP

4HRT-like55.41e-17451480231
         HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                      CGv+l +G +C+r+PvkgRKRCeeHKGmRi
  Carubv10026317m 451 CGVKLCNGLTCERSPVKGRKRCEEHKGMRI 480
                      *****************************7 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MEFGDGVSFA VVPTVFKRED YKRTKHDSVF SNWQVLIGSN DWEDFKNGKD GVCRYRVQNL  60
PRKSFPGLYE LGVAVIDSDQ GRKLEPDDVL AAYLGQAESV RSRLQRYGRS GAHLRNVYSL  120
FDCEIVESPV KKAATGGLFE DIFSKGGSIL YRWAPMGSKR VAEATEGMLL STFDYAWNKG  180
SNGERRQLDL LKKLGDRKFM SKRKPGISRV LFPFLSNQVG IRIKGEKHVL KEERKLSSDV  240
DEEKSTNFLS SILKLTRSRP QPVSDRFDEM DGSCTDSVCG VILENGGFCN RSPVKGRKRC  300
IEHKGQRVCR VSPEKQTPPP NLEIFTGQDR HSHKDSDVRC GVILPDMESC SKRAVQGRKR  360
CEDHKGMRIN AFLFLLNQTD REKTVKDDNS SDLESHRELN EEEEEALTRF CEATTKKGLP  420
CTRSPPKGSK RCWQHKEKTS PICFQPEIIA CGVKLCNGLT CERSPVKGRK RCEEHKGMRI  480
T*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankAB0133920.0AB013392.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MIK19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006280390.10.0hypothetical protein CARUB_v10026317mg
SwissprotF4K9330.0ET2_ARATH; Protein EFFECTOR OF TRANSCRIPTION 2
TrEMBLR0GQ090.0R0GQ09_9BRAS; Uncharacterized protein
STRINGAT5G56780.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29542763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.10.0effector of transcription2