PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10025699m
Common NameCARUB_v10025699mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 210aa    MW: 23729.3 Da    PI: 4.3065
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10025699mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF38.71.3e-121149139
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevavii 39
                     k+i +k  r vtfskRr+g+  KA+EL+ L d++ a++ 
  Carubv10025699m 11 KKIREKDPRGVTFSKRRTGLYSKASELCLLSDTQMAILT 49
                     67889999****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-10363IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.629348IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-8525IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.27E-15578IPR002100Transcription factor, MADS-box
CDDcd002668.92E-21582No hitNo description
PfamPF003191.3E-111253IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-82540IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MVGLKRKIDI KKIREKDPRG VTFSKRRTGL YSKASELCLL SDTQMAILTT PVSSNSHASF  60
YSFGHSSVDS VVAAFLTDQT PPRDEDDDDE KLGFWWEDES LVDTEDQEEL GEVIDSMKKM  120
LNDLKELENK RRDREDVEKE KGVSHVTCQE QTLIHQPCSS SLCFDQDDVT VNQEFSLDEI  180
FDLVTSSEVA EMNLGMSYNN KNNNALLGF*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10025699m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006296511.11e-154agamous-like MADS-box protein AGL97
SwissprotQ9C6338e-64AGL97_ARATH; Agamous-like MADS-box protein AGL97
TrEMBLR0HI751e-153R0HI75_9BRAS; Uncharacterized protein
STRINGXP_006296511.11e-153(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45417145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04640.19e-58AGAMOUS-like 99
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]