PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10025688m
Common NameCARUB_v10025688mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family B3
Protein Properties Length: 550aa    MW: 62289.4 Da    PI: 8.2543
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10025688mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B354.22.6e-1729117494
                      E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
               B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                      vl++  +lk + l lpk+++ +  ++k+++ +++l+d s++sWe+ l++++ sg +++t+GW++F+++ng k+g +++F+l++r ++++++
  Carubv10025688m  29 VLVTDANLKADSLNLPKDYTYSSVLNKTCH-KIVLTDGSNNSWELDLKFNQFSGCFYITRGWRHFCDENGKKAGNVFTFELTNR-GETPLL 117
                      567888999999********9999999997.*************************************************9875.444444 PP

2B341.81.9e-131342201196
                      HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE.....EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
               B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy...rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                      l +   ++p +f+ +hg++  e++++tl  ++g ++  +l+    + + gr+ lt+GW++Fvka +Lkeg+ ++F+ ++ +++++ +k+
  Carubv10025688m 134 LDKFVTYIPADFLGKHGLDI-ETRMVTLLRKDGTRMLATLSReysTSNLGRMSLTRGWRQFVKASHLKEGEHITFECIW-QNATPILKL 220
                      5555669*********9986.5579***************76666677777*************************999.666666665 PP

3B339.59.7e-13455543596
                      -..-HHHHTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEE CS
               B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkv 96 
                      l+p+dv +s  l+lp+kf++++g++k  + ++++    + +sW   l    k+g++  + GW++F++ ng+k g+++ ++++ r  ++++v+++
  Carubv10025688m 455 LVPADVKAST-LWLPRKFMKDNGINKI-G-KIVMWGrNEVESWCGFL--LSKDGMVAVGCGWENFCETNGVKIGESFSLEFIMRrADATPVLQF 543
                      7899999997.***********99975.4.4555551566***9999..99999**************************98555999998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.6E-1918122IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.1E-1720122IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.36726122IPR003340B3 DNA binding domain
SMARTSM010194.1E-1727123IPR003340B3 DNA binding domain
PfamPF023623.5E-1529116IPR003340B3 DNA binding domain
CDDcd100176.89E-1429119No hitNo description
PROSITE profilePS5086310.362124224IPR003340B3 DNA binding domain
SuperFamilySSF1019368.44E-12137220IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.3E-5137224IPR003340B3 DNA binding domain
PfamPF023622.0E-11138220IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.1E-12139220IPR015300DNA-binding pseudobarrel domain
CDDcd100171.45E-13140220No hitNo description
Gene3DG3DSA:2.40.330.104.1E-11448546IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.47E-12449544IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.377450546IPR003340B3 DNA binding domain
SMARTSM010193.4E-10451547IPR003340B3 DNA binding domain
CDDcd100172.77E-8452533No hitNo description
PfamPF023621.1E-10455544IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
LGRRKKVRTN KSEFKAGSSS SDDNNSFFVL VTDANLKADS LNLPKDYTYS SVLNKTCHKI  60
VLTDGSNNSW ELDLKFNQFS GCFYITRGWR HFCDENGKKA GNVFTFELTN RGETPLLTFS  120
PSNSTLSYET SEGLDKFVTY IPADFLGKHG LDIETRMVTL LRKDGTRMLA TLSREYSTSN  180
LGRMSLTRGW RQFVKASHLK EGEHITFECI WQNATPILKL TETKSNIPIK RSRKKYTRAS  240
KKVSTVSTKP NVGKEPEKDK NMEEPIITAL LPPTEDSRVV TEPLMNDEKE PEKDKNMEEP  300
ISALLPPTEN NRVVTEPNRN DGKEPKKDKN MEEPISPLLP PTENNRVVTE PNRNDGKESE  360
KDKNMEEPRS PLKPPTENNR VVTESNRNDG KELEKDNNME EPRSPLQPPT ENNRVVTEPN  420
RDDGKELEKD QNIEEPTSPL ISSLIQNRRV VVLPLVPADV KASTLWLPRK FMKDNGINKI  480
GKIVMWGRNE VESWCGFLLS KDGMVAVGCG WENFCETNGV KIGESFSLEF IMRRADATPV  540
LQFKPKSRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006296501.10.0hypothetical protein CARUB_v10025688mg, partial
SwissprotF4IQL74e-51REML2_ARATH; B3 domain-containing protein REM-like 2
TrEMBLR0HI610.0R0HI61_9BRAS; Uncharacterized protein (Fragment)
STRINGscaffold_400529.15e-67(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78281641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24696.14e-51B3 family protein