PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10025656m
Common NameCARUB_v10025656mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 174aa    MW: 19631.2 Da    PI: 8.2004
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10025656mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF60.61.8e-191257449
                     -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     ++   rqvtfskRr+g++KKA+EL +LC+ae  +++fs+ gk + y
  Carubv10025656m 12 QDMNTRQVTFSKRRTGLFKKASELATLCNAELGIVVFSPGGKPFSY 57
                     56778**********************************9996665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.006161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.71E-26171IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-32160IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-19323IPR002100Transcription factor, MADS-box
PfamPF003192.8E-231257IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MGRRKIKMEM VQDMNTRQVT FSKRRTGLFK KASELATLCN AELGIVVFSP GGKPFSYGKP  60
DLDSVVERFM RDDDESDSGD EEGRARNGPK LKKMSERLDS LNQEIEAEKK RGEKDQEKLE  120
SAGDERFKKP IEALTLDELN EYKDKLKTVH GRIEGDAYRV HASSCLLSLS VKN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A5e-17178178MEF2C
5f28_B5e-17178178MEF2C
5f28_C5e-17178178MEF2C
5f28_D5e-17178178MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10025656m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0040771e-151AC004077.3 Arabidopsis thaliana chromosome 2 clone T31E10 map ve016, complete sequence.
GenBankAC0044811e-151AC004481.3 Arabidopsis thaliana chromosome 2 clone F13P17 map ve016, complete sequence.
GenBankCP0026851e-151CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBankDQ4465981e-151DQ446598.1 Arabidopsis thaliana clone pENTR221-At2g34440 MADS-box family protein (At2g34440) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006296471.11e-124agamous-like MADS-box protein AGL29
SwissprotO647036e-99AGL29_ARATH; Agamous-like MADS-box protein AGL29
TrEMBLR0HI381e-122R0HI38_9BRAS; Uncharacterized protein
STRINGXP_006296471.11e-123(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.19e-94AGAMOUS-like 29
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]