PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10025436m
Common NameCARUB_v10025436mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 532aa    MW: 58700 Da    PI: 9.844
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10025436mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.71.4e-09417471357
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                      e+k+ +r+  NRe+A rs +RK  +++ Le+++ +L++e  +L  ++  l+k+ a
  Carubv10025436m 417 EDKKKKRLLANRESAARSKERKDSYVASLERRIMSLQSEYNSLYHTVTVLEKNKA 471
                      89*****************************************999999998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-8415479IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.852417480IPR004827Basic-leucine zipper domain
PfamPF001702.8E-8417471IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.58E-9419469No hitNo description
Gene3DG3DSA:1.20.5.1706.0E-9419476No hitNo description
CDDcd147031.66E-17420471No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MAPLSIQYQN PFRNNDDDAG KRTDVSKYRQ VPPVSRYPAG SPHFSPGPRF TQSSPTFSYI  60
PQTSPSSTSF HTSLAHVYRP SPSPYRPPVS PSPSSFRPPV CPSPSPYRPR LCPSPSSYRP  120
PVCPSQFGRG SFPHSNPKPQ LETQLMPVIS STPPPPSHIY YSNMSVSQPA PVYSSVPSSP  180
MSSSILSMTQ PSPVLSNFPS STEYYSSYPS VSNMAPVFSS SPSSPIYSSN MPVTQSKPVF  240
SSLLSSPDNS SYSLMNQSNH VSTLSLVDYS GSQGTQPGHV SSSIPSSHVH SSMLSSPSLA  300
CGEPLLPRYP TPPSSHVDNR VSNMRFSQNP SPLPPLVPVR KFKSGPTTIS GVKRRAGKEI  360
DPRTRHYQNV PMDSCFNDMI KTSLSPQVNF PVDGNGGYSS LKSKTYAQSI REIESHEDKK  420
KKRLLANRES AARSKERKDS YVASLERRIM SLQSEYNSLY HTVTVLEKNK AMTMQEIKQM  480
QLRIQYLEDM KLIRDEISML KGESTLSGQE SVDAQRLKEA IVVNQQMSAE IE
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10025436m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006296262.20.0vegetative cell wall protein gp1
TrEMBLR0HUS20.0R0HUS2_9BRAS; Uncharacterized protein (Fragment)
STRINGXP_006296262.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3356822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G12940.13e-27bZIP family protein