PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10025009m
Common NameCARUB_v10024652mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 91aa    MW: 10702.6 Da    PI: 10.4006
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10025009mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF595.7e-19957149
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     krie +  r+  +skR+ng+lKKA+E+ vLC++++a+iifs+++k   y
  Carubv10025009m  9 KRIECSKERSDKYSKRKNGLLKKAQEIEVLCNIDIALIIFSPKNKANIY 57
                     799****************************************996655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-23160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.329161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-24277IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-17323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-171054IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MGRKKIDLKR IECSKERSDK YSKRKNGLLK KAQEIEVLCN IDIALIIFSP KNKANIYHSG  60
SFGKILEKFC KISLQEREER FDRSRFYIIF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6bz1_A2e-14173173MEF2 CHIMERA
6bz1_B2e-14173173MEF2 CHIMERA
6bz1_C2e-14173173MEF2 CHIMERA
6bz1_D2e-14173173MEF2 CHIMERA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10025009m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006295879.25e-50agamous-like MADS-box protein AGL65
TrEMBLR0G0421e-56R0G042_9BRAS; Uncharacterized protein
TrEMBLR0HFL41e-56R0HFL4_9BRAS; Uncharacterized protein
STRINGXP_006295546.12e-57(Capsella rubella)
STRINGXP_006295879.12e-57(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26320.15e-33AGAMOUS-like 33