PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10024914m
Common NameCARUB_v10024914mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 216aa    MW: 24327.1 Da    PI: 9.75
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10024914mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.91e-211961345
                     --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
           SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     i+ +s rqvtfskRr+g++KKA+EL++LC+ae+ +i+fs+  k
  Carubv10024914m 19 IKKESHRQVTFSKRRAGLFKKASELCTLCGAEIGIIVFSPAKK 61
                     8999***********************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.591969IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-30968IPR002100Transcription factor, MADS-box
CDDcd002656.67E-351085No hitNo description
SuperFamilySSF554551.44E-281092IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-171131IPR002100Transcription factor, MADS-box
PfamPF003192.9E-251865IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-173146IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-174667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009559Biological Processembryo sac central cell differentiation
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MMSKKKESIG RQKIPMVKIK KESHRQVTFS KRRAGLFKKA SELCTLCGAE IGIIVFSPAK  60
KPFSFGHPSV ESVLDRYMSR NNMSLAQTTQ QQPQGNPAAG CELNMQLTQV LSEVEEEKKK  120
GQAMEEIRKA SVRRSATNWW EKPVEEMNMF QLQEMKNALE ELRKTVVANM APYTEVKEDV  180
YGFLDNKVAT APHPYMNMSS GLSSIYSFAN GNNCF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A9e-16994193MEF2 CHIMERA
6byy_B9e-16994193MEF2 CHIMERA
6byy_C9e-16994193MEF2 CHIMERA
6byy_D9e-16994193MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10024914m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006295790.11e-161agamous-like MADS-box protein AGL61
SwissprotQ4PSU41e-127AGL61_ARATH; Agamous-like MADS-box protein AGL61
TrEMBLR0HX761e-160R0HX76_9BRAS; Uncharacterized protein
STRINGXP_006295790.11e-160(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.11e-129AGAMOUS-like 61
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]