PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10024749m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 108aa    MW: 12520.9 Da    PI: 10.1842
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10024749mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF404.9e-131053245
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     +ie    r+  +skR++gilKK e L  LC++++ ++++s+t+k
  Carubv10024749m 10 KIECPKERSNKYSKRKKGILKKTEQLALLCNVDIVMVLISPTNK 53
                     67777889999*******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.3E-18160IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.02E-19179IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.203161IPR002100Transcription factor, MADS-box
CDDcd002662.85E-16282No hitNo description
PRINTSPR004041.2E-10323IPR002100Transcription factor, MADS-box
PfamPF003193.2E-141055IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 108 aa     Download sequence    Send to blast
MGKMKIELKK IECPKERSNK YSKRKKGILK KTEQLALLCN VDIVMVLISP TNKPTIFHTP  60
SRNLSQILKN FSNISIHERE ERFDLSDCHI TITLCTLHNF IVFFLFI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10024749m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006296441.21e-44agamous-like MADS-box protein AGL65
TrEMBLR0HI121e-62R0HI12_9BRAS; Uncharacterized protein (Fragment)
STRINGXP_006296441.12e-63(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73301838
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26320.13e-33AGAMOUS-like 33