![]() |
Plant Transcription
Factor Database
v4.0
Previous version: v1.0,
v2.0,
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Carubv10024311m | ||||||||
Common Name | CARUB_v10024311mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 131aa MW: 15321.2 Da PI: 8.0704 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 139 | 1.3e-43 | 52 | 129 | 1 | 78 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +Cqve+C+ad+s+ak+yh+rhkvCe+h+kap v +sgl+qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk+++ Carubv10024311m 52 VCQVESCTADMSKAKQYHKRHKVCEFHAKAPIVRISGLHQRFCQQCSRFHELGEFDEAKRSCRRRLAGHNERRRKTAT 129 6**************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 6.9E-57 | 1 | 130 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 1.2E-33 | 47 | 114 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.385 | 50 | 127 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.47E-38 | 52 | 128 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 5.2E-33 | 53 | 126 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009911 | Biological Process | positive regulation of flower development | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0010229 | Biological Process | inflorescence development | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046872 | Molecular Function | metal ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 131 aa Download sequence Send to blast |
MSMRRSKAEG KRCLRELSEE EEEEETEDED TFEEEEALEK KQKGKVTSSS RVCQVESCTA 60 DMSKAKQYHK RHKVCEFHAK APIVRISGLH QRFCQQCSRF HELGEFDEAK RSCRRRLAGH 120 NERRRKTATE * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 2e-39 | 47 | 126 | 5 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00290 | DAP | Transfer from AT2G33810 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT005443 | 1e-166 | BT005443.1 Arabidopsis thaliana clone U50647 putative squamosa-promoter binding protein (At2g33810) mRNA, complete cds. | |||
GenBank | AK118179 | 1e-166 | AK118179.1 Arabidopsis thaliana At2g33810 mRNA for putative squamosa-promoter binding protein, complete cds, clone: RAFL19-50-A02. | |||
GenBank | Y09427 | 1e-166 | Y09427.1 A.thaliana mRNA for squamosa-promoter binding protein like 3. | |||
GenBank | AJ242959 | 1e-166 | AJ242959.1 Arabidopsis thaliana mRNA for Squamosa promoter binding protein-like 3 (SPL3 gene). | |||
GenBank | AJ011633 | 1e-166 | AJ011633.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 3. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006295226.1 | 1e-88 | hypothetical protein CARUB_v10024311mg | ||||
Swissprot | P93015 | 3e-66 | SPL3_ARATH; Squamosa promoter-binding-like protein 3 | ||||
TrEMBL | R0HES9 | 2e-88 | R0HES9_9BRAS; Uncharacterized protein | ||||
STRING | fgenesh2_kg.4__1394__AT2G33810.1 | 5e-66 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM868 | 28 | 118 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 2e-60 | squamosa promoter binding protein-like 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Carubv10024311m |
Entrez Gene | 17887794 |