PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10023649m
Common NameCARUB_v10023644mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 322aa    MW: 35789.4 Da    PI: 6.2435
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10023649mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.11.2e-10190233548
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                      kr +r   NR +A+rsR RK+++i eLe+ v +L+ae + L  +
  Carubv10023649m 190 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQAEVSVLSPR 233
                      8999********************************98877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-13186250IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.622188240IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.86E-11190244No hitNo description
Gene3DG3DSA:1.20.5.1704.1E-13190241No hitNo description
PfamPF001704.2E-9190234IPR004827Basic-leucine zipper domain
CDDcd147037.48E-24191241No hitNo description
PROSITE patternPS000360193208IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MAQLPPKIPN MTPHWPDFSS QKLSPFSTPT ATVAAATTTV QNPSWVDEFL DFSASRRGNH  60
RRSISDSIAF LEAPTVSDHV SIENIHFDRF DDEQFMSMFT DDGDLQNNTS HINNILGTTG  120
SSSNTPTPSN SINDDNKEPP SIYHDMNNTN NNCNNNNDEV QSQCKTEPDD GSASNNNSGD  180
SSGNRILDPK RVKRILANRQ SAQRSRVRKL QYISELERSV TSLQAEVSVL SPRVAFLDHQ  240
RLLLNVDNSA LKQRIAALSQ DKIFKDAHQE SLKREIERLR QVYNQQSLTK MDNANHSPAT  300
GAVAASAVEI KKSIEKEQLL N*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator involved in the sporophytic control of cell wall patterning and gametophytic control of pollen development. May play a role in the control of metabolic pathways regulating cellular transport and lipid metabolism. {ECO:0000269|PubMed:17719007, ECO:0000269|PubMed:19449183}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10023649m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294608.10.0basic leucine zipper 34
SwissprotF4IN231e-167BZP34_ARATH; Basic leucine zipper 34
TrEMBLR0FXS20.0R0FXS2_9BRAS; Uncharacterized protein
TrEMBLR0HQG60.0R0HQG6_9BRAS; Uncharacterized protein
STRINGXP_006294608.10.0(Capsella rubella)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.21e-152bZIP family protein
Publications ? help Back to Top
  1. Jiang J,Zhang Z,Cao J
    Pollen wall development: the associated enzymes and metabolic pathways.
    Plant Biol (Stuttg), 2013. 15(2): p. 249-63
    [PMID:23252839]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Gibalov√° A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]