PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10023364m
Common NameCARUB_v10023364mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 399aa    MW: 44903.7 Da    PI: 6.5193
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10023364mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.81.5e-10200258563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l  l+     l+ e+
  Carubv10023364m 200 KRAKRIWANRQSAARSKERKTRYIFELERKVQTLQTEATTLSAQLTLLQRDTNGLTVEN 258
                      9********************************************99998887777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.2E-15196260IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.565198261IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.04E-10200251No hitNo description
PfamPF001707.0E-9200252IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.6E-11200254No hitNo description
CDDcd147034.24E-22201250No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MDKEKSPAPC GGLPPPSPSG RCSAFSDSGP SGHGSDANRM SHDISRMLDK PPKKIGHRRS  60
HSEILTLPDD LSFDSDLGVV GNAVDGASFS DETEEDLLSM YLDMDKFNSS ASSSAQVGEP  120
SGTAWKNESM MQTGSTSIPH ITINSFAERP RIRHQHSQSM DGSMNINEML MSGNEDDSAI  180
DTKKSMSATK LAELALIDPK RAKRIWANRQ SAARSKERKT RYIFELERKV QTLQTEATTL  240
SAQLTLLQRD TNGLTVENNE LKLRLQTMEQ QVHLQDELNE ALKEEIQHLK VLTGQVAPSA  300
LNYGSFGSNQ QQFYSNNQSM QTILAAQQFQ QLQIHSQKQQ QQQQQQQQQQ QQQQQQQQQQ  360
QQYQFQQQQM QQLMQQRIQQ QEQQNGVRLK PSQSQKES*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10023364m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3170870.0AK317087.1 Arabidopsis thaliana AT2G31370 mRNA, complete cds, clone: RAFL21-87-G20.
GenBankAY0575340.0AY057534.1 Arabidopsis thaliana At2g31370/T28P16.14 mRNA, complete cds.
GenBankAY1130580.0AY113058.1 Arabidopsis thaliana At2g31370/T28P16.14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294347.10.0probable transcription factor PosF21 isoform X1
RefseqXP_023640070.10.0probable transcription factor PosF21 isoform X1
RefseqXP_023640071.10.0probable transcription factor PosF21 isoform X1
SwissprotQ040880.0POF21_ARATH; Probable transcription factor PosF21
TrEMBLR0HPN40.0R0HPN4_9BRAS; Uncharacterized protein
STRINGXP_006294347.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24452772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31370.50.0bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]