PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10023063m
Common NameCARUB_v10023063mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 501aa    MW: 54453.7 Da    PI: 9.9007
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10023063mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.26.2e-12350408563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      kr +r   NR++A rs +RK  +++eLe kv++L++e ++L  +l +l+  +  l+s++
  Carubv10023063m 350 KRVKRIFANRVSAARSKERKTRYMAELEHKVQTLQTEATTLSAQLTHLQRDSMGLTSQN 408
                      899999******************************************99998888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-17346410IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.611348411IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.3E-12350407No hitNo description
PfamPF001703.9E-10350408IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.9E-11350405No hitNo description
CDDcd147034.78E-20351400No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0010628Biological Processpositive regulation of gene expression
GO:0010629Biological Processnegative regulation of gene expression
GO:0090567Biological Processreproductive shoot system development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MGGGGDTDTN MMQRVNSSSG TSSSLIPKQI SSNLHLNPAL IRSQNHHFRQ PFTGPPPPIP  60
PVSPYSQIPA TLQLKHSRSM SQPSSYFSFD SLPPLNPSPQ PVPVSVEEKN GVGFSPSLPP  120
SPFTMCHSSS SRNAGDGENL PPKKSHRRSN SDVTFGFGSV MAQNQKTPPL VPSRSLERSI  180
SGGKVSDWSN LVKEEPREGF AKARKSEGEA AMDDVFTAYM NLDNIDVLNS FGGEDGKNAN  240
GNVEEMESSR GSGTKKTNGG ISSDSEGESS ASGNVKVAVS SSSGVKRRAG GDNSPNTRHF  300
RSVSMDSSFM GKLNFGDESL LKLNGEFTEA EMKKIAADEK LAEIVMSDPK RVKRIFANRV  360
SAARSKERKT RYMAELEHKV QTLQTEATTL SAQLTHLQRD SMGLTSQNSE LKFRLQAMEQ  420
QAQLRDALSE KLTEEVHRLK LVIGEPSRRQ SGISSSGTNI SKTSLNPEMF QQLSISQLQH  480
QQMQHSNQNS TMKAKHTSNE *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00037PBMTransfer from AT2G21230Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10023063m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294070.10.0transcription factor RF2a
RefseqXP_023639860.10.0transcription factor RF2a
TrEMBLR0HSG30.0R0HSG3_9BRAS; Uncharacterized protein
STRINGXP_006294069.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM156251417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21230.10.0bZIP family protein