PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10022722m
Common NameCARUB_v10022722mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 726aa    MW: 78842.4 Da    PI: 6.0403
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10022722mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.62.7e-13228289162
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      e++ k+  r+++NRe+A+ sRqRKk ++eeLeekv ++ +  ++L  +++    e a+l+++
  Carubv10022722m 228 EEDEKKKARLMRNRESAQLSRQRKKHYVEELEEKVRNMHSTITDLNGKISYFMAENATLRQQ 289
                      678899******************************************99999999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-16228292IPR004827Basic-leucine zipper domain
PfamPF001703.1E-11229290IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.3230290IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.9E-17232290No hitNo description
SuperFamilySSF579594.82E-12232290No hitNo description
CDDcd147041.25E-21233284No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 726 aa     Download sequence    Send to blast
MAEPIMEQPP PPAPDPNSTH PPIPPSDFDS ISIPPFDDQF YHPGSDQTPI GELMSDLGFP  60
DGEFELTFDG MDDLYFPAEN ESFLIPVNTS SQEQFGDFTP DSEGSGISGD PKDVFKNITT  120
SGCSNRESPR DSDDRCSGAD PSLDLPTPLS SQGSGNCASD VSEATNESSP KSRNVVVDQK  180
VKVEEAATTT SITKRKKEIE EDLSGESRSS KYRRSGEEDI DASAVTGEED EKKKARLMRN  240
RESAQLSRQR KKHYVEELEE KVRNMHSTIT DLNGKISYFM AENATLRQQL GGNGMCPPHH  300
PPPPMGMYPP MAPMPYPWMP CPPYMVKQQG SQVPLIPIPR LKPQNPLGTS KAKKSESKKS  360
EAKTKKVASI SFLGLLFCLF LFGALAPIVN VNYGGISGAF YGNYRPNYIT DQIYSQHRDR  420
VLDTSRSGAG TGVSNSNGMD CGRDSDRGTR NNISATESSV PPGNGSEPLV ASLFVPRNDK  480
LVKIDGNLII NSILASEKAV ASRKASESNE RKADLVIPKD YSPALPLPDV GRTEEMAKHL  540
YRSKTEKQKA LSSGSADSLK DQFKTKAANG EMQQWFREGV AGPMFSSGMC TEVFQFDVSS  600
TSGAIIPASP ATNVSAEHSK NTTDTRKRKN RRILRGLPIP LPGSDFNLTK EHQRNSSSKE  660
IKPASSMVVS VLVDPREGGD GDIDGMIGGP KSLSRVFVVV LLDSAKYVTY SCVLPRSGAP  720
HLVTT*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator involved in salt and osmotic stress responses. Functions as a stress sensor and transducer in a signaling pathway that resembles an ER stress response. Following salt stress, BZIP17 is cleaved by SBT6.1 (S1P) and S2P at the C-terminus and the N-terminal bZIP component is translocated to the nucleus, where it activates the expression of salt stress response genes (PubMed:17662035). Functions as a stress sensor and transducer in ER stress signaling pathway. ER stress induces proteolysis of BZIP17 by SBT6.1 (S1P) and S2P, and the N-terminal bZIP component is translocated to the nucleus, where it activates the expression and production of ER chaperones, as well as protein involved in brassinosteroid (BR) signaling, which is required for stress acclimation and growth (PubMed:20876872). {ECO:0000269|PubMed:17662035, ECO:0000269|PubMed:20876872}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10022722m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1362950.0AY136295.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
GenBankBT0004080.0BT000408.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006293762.10.0bZIP transcription factor 17
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLR0HN450.0R0HN45_9BRAS; Uncharacterized protein
STRINGXP_006293762.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein
Publications ? help Back to Top
  1. Zhou SF, et al.
    Membrane-associated transcription factor peptidase, site-2 protease, antagonizes ABA signaling in Arabidopsis.
    New Phytol., 2015. 208(1): p. 188-97
    [PMID:25919792]
  2. Sagor GH, et al.
    The polyamine spermine induces the unfolded protein response via the MAPK cascade in Arabidopsis.
    Front Plant Sci, 2015. 6: p. 687
    [PMID:26442007]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  4. Kim JS,Yamaguchi-Shinozaki K,Shinozaki K
    ER-Anchored Transcription Factors bZIP17 and bZIP28 Regulate Root Elongation.
    Plant Physiol., 2018. 176(3): p. 2221-2230
    [PMID:29367234]
  5. Cifuentes-Esquivel N, et al.
    bZIP17 regulates the expression of genes related to seed storage and germination, reducing seed susceptibility to osmotic stress.
    J. Cell. Biochem., 2018. 119(8): p. 6857-6868
    [PMID:29693271]
  6. Guan P, et al.
    SENSITIVE TO SALT1, An Endoplasmic Reticulum-Localized Chaperone, Positively Regulates Salt Resistance.
    Plant Physiol., 2018. 178(3): p. 1390-1405
    [PMID:30287478]