PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10022197m
Common NameCARUB_v10022197mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 221aa    MW: 24830.6 Da    PI: 4.4658
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10022197mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF351.8e-111249239
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevavii 39
                     +i  k  r vtfskRr+g+  KA+ L+ L da+ a++ 
  Carubv10022197m 12 KIGKKDPRAVTFSKRRKGLYSKASDLCLLSDAQMAILA 49
                     6777888***************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.1E-11363IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.138348IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.23E-16583IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-7525IPR002100Transcription factor, MADS-box
PfamPF003192.1E-111253IPR002100Transcription factor, MADS-box
CDDcd002662.86E-171982No hitNo description
PRINTSPR004042.2E-72540IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MGGLKRKIDI KKIGKKDPRA VTFSKRRKGL YSKASDLCLL SDAQMAILAT PVSSNSHASF  60
YSFGHSSVDS VVEAFLTDQT PPRNDDGDDE KLGFWWEDES LIDSEDPEEL GEMIDSMKKM  120
LHDLKELENK GRDQQTLNHQ PCSSSQCIDQ VDVTVNHVEG FHNNTEEQTL PVSDYINNNN  180
GLLGSYDRCD QEFLDQIVSE FLKNTEVPLM HLRAIDDLGY *
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10022197m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023644286.11e-150agamous-like MADS-box protein AGL97
SwissprotQ9C6333e-70AGL97_ARATH; Agamous-like MADS-box protein AGL97
TrEMBLR0HXS31e-163R0HXS3_9BRAS; Uncharacterized protein
STRINGXP_006301736.11e-164(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45417145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46408.11e-63AGAMOUS-like 97
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]