PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10022082m
Common NameCARUB_v10022082mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 131aa    MW: 15257.3 Da    PI: 10.7246
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10022082mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.63e-1446101358
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                      + ++ rrk +NRe+ArrsR RK+  ++eL     +L +eNk+L +el+  ++ ++k
  Carubv10022082m  46 DERKRRRKVSNRESARRSRMRKRRHMDELWSMLVQLINENKTLVDELNGVREGYEK 101
                      5578899*****************************************99998886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.6E-1238101No hitNo description
SMARTSM003383.7E-1544108IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.02446109IPR004827Basic-leucine zipper domain
PfamPF001702.8E-1148105IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.38E-114898No hitNo description
PROSITE patternPS0003605166IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MAGFVYNNLP SANPNPQSLF QTFVDRVPLS NLPATSDKSS RSAEDDERKR RRKVSNRESA  60
RRSRMRKRRH MDELWSMLVQ LINENKTLVD ELNGVREGYE KVIEENTKLR EENSKFRKMI  120
GEIGLSRFLN *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14751RKRRR
25068RRKVSNRESARRSRMRKRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10022082m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006301639.12e-90basic leucine zipper 8
SwissprotQ9CA466e-74BZIP8_ARATH; Basic leucine zipper 8
TrEMBLR0GFF55e-89R0GFF5_9BRAS; Uncharacterized protein
STRINGXP_006301639.19e-90(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM150351619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68880.11e-64basic leucine-zipper 8
Publications ? help Back to Top
  1. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]