PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10021917m
Common NameCARUB_v10021917mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 377aa    MW: 42579.3 Da    PI: 4.2056
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10021917mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF337.5e-111148138
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevavi 38
                     k+i  k  r vtfskRr+g+  KA+ L+ L da+  ++
  Carubv10021917m 11 KKIAKKDPRAVTFSKRRKGLYSKASDLCLLSDAQMVIL 48
                     56888899**************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.0E-11363IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.942348IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-7525IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-15580IPR002100Transcription factor, MADS-box
PfamPF003198.6E-111253IPR002100Transcription factor, MADS-box
CDDcd002663.09E-161982No hitNo description
PRINTSPR004043.4E-72540IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MVGLKRKIDI KKIAKKDPRA VTFSKRRKGL YSKASDLCLL SDAQMVILAT PVSSNSHASF  60
YSFGHSSVDS VVEAFLTDQT PPRDDYEKLG FWWEDESLAN SENPEELGEA LGSMTMMLHD  120
LKELVKRRDR VDVKKEKGVS HVTCQEPTLI HQPCSSSLCV DDQDDLTVNV QGFHNNNEEQ  180
AHSEAVVDGD QLVVITNRDL CDNNIHLSDL DEHQILAISD NTNEEQTHSE AVVDGDQLVE  240
TNRDLCDNNI HLSDLDEDQI LAISDNNNNN NNNKNNVLPE DLSWFNEELD IDQLIDYEMN  300
LEMDGETKQS MFSVSETVEE GGVSHKDLDE DNLCFSDYFN ETIPCFVVCL KFPLLTFLTY  360
CVRVMSLYQT NKIKLC*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10021917m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023644285.10.0agamous-like MADS-box protein AGL97
SwissprotQ9C6331e-63AGL97_ARATH; Agamous-like MADS-box protein AGL97
TrEMBLR0I8G70.0R0I8G7_9BRAS; Uncharacterized protein
STRINGXP_006301492.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45417145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04640.12e-69AGAMOUS-like 99
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]