PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10021825m
Common NameCARUB_v10021825mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 223aa    MW: 25283.8 Da    PI: 9.7703
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10021825mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.81.2e-224694149
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     kri ++ +rqvtfskRr g++KKA ELSvLC+a++ +i fs + ++y +
  Carubv10021825m 46 KRITEENRRQVTFSKRRSGLFKKAAELSVLCGAQIGIITFSRSERIYSF 94
                     799*******************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.7E-303897IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.13898IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.62E-2439108IPR002100Transcription factor, MADS-box
CDDcd002659.76E-3139105No hitNo description
PRINTSPR004042.8E-214060IPR002100Transcription factor, MADS-box
PfamPF003196.0E-234794IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-216075IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-217596IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MEDGEASTIT CLPTTKQNPN LLVNQKKESK EQKPKTTKGR QKIEIKRITE ENRRQVTFSK  60
RRSGLFKKAA ELSVLCGAQI GIITFSRSER IYSFGNVGTL IDKYLRKTPV MLRSNRGGDV  120
PTGEENNDGL MWWERAVESV PEEDMEEYKK ALSALRENLL TRIYQMGNDR TAENLPAFPN  180
DMAMADWKLT NENLMARNNR GYVGNDAGLD FGVPFMSQKP RQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A3e-1539107167Myocyte-specific enhancer factor 2A
3kov_B3e-1539107167Myocyte-specific enhancer factor 2A
3kov_I3e-1539107167Myocyte-specific enhancer factor 2A
3kov_J3e-1539107167Myocyte-specific enhancer factor 2A
3p57_A3e-1539107167Myocyte-specific enhancer factor 2A
3p57_B3e-1539107167Myocyte-specific enhancer factor 2A
3p57_C3e-1539107167Myocyte-specific enhancer factor 2A
3p57_D3e-1539107167Myocyte-specific enhancer factor 2A
3p57_I3e-1539107167Myocyte-specific enhancer factor 2A
3p57_J3e-1539107167Myocyte-specific enhancer factor 2A
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10021825m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006301410.11e-165agamous-like MADS-box protein AGL61
TrEMBLR0ICD31e-163R0ICD3_9BRAS; Uncharacterized protein
STRINGXP_006301410.11e-164(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46972052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72350.11e-119M-type_MADS family protein