PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10021761m
Common NameCARUB_v10021761mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 247aa    MW: 28737.8 Da    PI: 7.5467
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10021761mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF72.92.6e-23958150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     krie ++nrq+t+skR++g++KKA+ELS+LCd++ a+++fs++++l  +s
  Carubv10021761m  9 KRIEKTTNRQITYSKRKKGLIKKAYELSTLCDIDLALLMFSPSDRLCLFS 58
                     79*****************************************9997765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.651161IPR002100Transcription factor, MADS-box
SMARTSM004325.6E-30160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.06E-26281IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-21323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003197.4E-221055IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-212338IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-213859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGRVKLELKR IEKTTNRQIT YSKRKKGLIK KAYELSTLCD IDLALLMFSP SDRLCLFSGQ  60
TRIEDVFARY INLPDQEREN AIVFPDRSKR QLGFQNKEYL LRTLEQLKTE DDMALQINEP  120
RFQLEQEVCR LQKQLQISEE ELRKFEPDPV RFTSMEETEA CETHLIDTLT RVVQRREHLL  180
NKSSKAPSTQ HSMEGILLND VAEEWASVTE PKQTHMIANS VHHSNPLSYE MLLLQRSTSS  240
SNKNPK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6bz1_A3e-16191192MEF2 CHIMERA
6bz1_B3e-16191192MEF2 CHIMERA
6bz1_C3e-16191192MEF2 CHIMERA
6bz1_D3e-16191192MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10021761m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0121281e-119BT012128.1 Arabidopsis thaliana At1g77950 mRNA, complete cds.
GenBankBT0123851e-119BT012385.1 Arabidopsis thaliana At1g77950 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023644002.11e-176agamous-like MADS-box protein AGL66
SwissprotQ1PFC22e-99AGL66_ARATH; Agamous-like MADS-box protein AGL66
TrEMBLR0I8160.0R0I816_9BRAS; Uncharacterized protein
STRINGXP_006301352.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21792365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77950.21e-147AGAMOUS-like 67
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]