PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10021362m
Common NameCARUB_v10021362mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 153aa    MW: 17388.6 Da    PI: 5.2923
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10021362mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF24.82.7e-081341649
                     HHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF 16 RrngilKKAeELSvLCdaevaviifsstgklyey 49
                     Rrngi  K  ELSvLC++ +a + +  +gk +++
  Carubv10021362m  1 RRNGIYTKLCELSVLCGVHIAFLGYTDSGKPFTF 34
                     9****************************99998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.03E-11154IPR002100Transcription factor, MADS-box
PfamPF003191.7E-9134IPR002100Transcription factor, MADS-box
PROSITE profilePS5006612.657138IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
RRNGIYTKLC ELSVLCGVHI AFLGYTDSGK PFTFGSPSFQ AVAERFLNSE ASSSSSLQQS  60
LFTVHHKQNV QELCTLYNNL VEQTRAEEVK AMKAAASMEP FPEDAWWKMH MTKEQDQEEA  120
KMLLDKFEGL YEKLCDEIDV RSQRRDAARN DI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10021362m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006301053.11e-111agamous-like MADS-box protein AGL29
TrEMBLR0GE101e-111R0GE10_9BRAS; Uncharacterized protein (Fragment)
STRINGXP_006300973.11e-112(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46761352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29962.18e-53AGAMOUS-like 64