PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10021360m
Common NameCARUB_v10021360mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 164aa    MW: 18622.8 Da    PI: 9.1529
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10021360mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF42.48.7e-141150342
                     --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
           SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                     i ++  r  tf kR++g+lKK +EL +LC+  ++ ii+s+
  Carubv10021360m 11 ITDNATRRATFQKRKAGLLKKINELTILCGLPACAIIYSE 50
                     677888999******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-15160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.086150IPR002100Transcription factor, MADS-box
CDDcd002667.31E-21285No hitNo description
SuperFamilySSF554552.49E-20295IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-7323IPR002100Transcription factor, MADS-box
PfamPF003193.7E-141150IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MGRRKVTHQL ITDNATRRAT FQKRKAGLLK KINELTILCG LPACAIIYSE YKDGPELWPN  60
VNEVRSLLDR LSELPVEKQI KYMMDQKDLM EKMIKDAEKK LEKEKKHTHA MNLGIMASTN  120
DLTTESDCSE ELVKAAEVVD KKLKLIQERI KAVEAGAPII MRD*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10021360m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2546010.0AC254601.1 Capsella rubella clone CAP30-M05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006300971.11e-117agamous-like MADS-box protein AGL80
TrEMBLR0HVJ51e-115R0HVJ5_9BRAS; Uncharacterized protein
STRINGXP_006300971.11e-116(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22590.21e-94AGAMOUS-like 87