PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10020523m
Common NameCARUB_v10020527mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 364aa    MW: 41009.7 Da    PI: 9.6974
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10020523mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.98.9e-082322781763
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      A+rsR RK+++i eLe+ v++L+ae ++   el+ l++    l +e+
  Carubv10020523m 232 AQRSRVRKLQYISELERNVQTLQAEGSKVSAELDFLNQRNLILSMEN 278
                      89********************************9999887777666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0067220280IPR004827Basic-leucine zipper domain
CDDcd147031.72E-14225271No hitNo description
Gene3DG3DSA:1.20.5.1703.2E-7232274No hitNo description
SuperFamilySSF579596.88E-6232274No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MASSKGSQSV KNLMYPGKHA LLPPKIPFPN VSASYTEYIP SGLIGSRHGQ KLGDEKTHHQ  60
RTSSESQLVE ELPFWLDDLL NEPESPARKC GHRRSSSDSY AYLDVANATN ISLTLQNDFS  120
YRNTVSSTQR GMQDAAFYSD ANFQKQKSRQ RDSLVASGAR PSWLPFTREN PGGKNMGSSY  180
MSQEATVLSE RKNYAEPLSH DPKMFSSEEN NSNPPPVTYE ADNSKRAKQQ FAQRSRVRKL  240
QYISELERNV QTLQAEGSKV SAELDFLNQR NLILSMENKA LKQRLESIAQ EKLIKQLEQE  300
VLEKEIGRLR ALYQLQQQTQ KPSASRGRAT SKDLESQFSS LSLNTKDSNC RRDSVSVMGQ  360
FHF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10020523m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0039800.0BT003980.1 Arabidopsis thaliana clone RAFL15-22-D03 (R20596) putative bZIP family transcription factor (At1g58110) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302442.10.0uncharacterized protein At4g06598
SwissprotQ8W3M73e-59Y4598_ARATH; Uncharacterized protein At4g06598
TrEMBLR0IB210.0R0IB21_9BRAS; Uncharacterized protein
STRINGXP_006302442.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33602444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.20.0bZIP family protein
Publications ? help Back to Top
  1. Kumekawa N,Hosouchi T,Tsuruoka H,Kotani H
    The size and sequence organization of the centromeric region of Arabidopsis thaliana chromosome 4.
    DNA Res., 2001. 8(6): p. 285-90
    [PMID:11853315]