PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10020457m
Common NameCARUB_v10020457mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GeBP
Protein Properties Length: 384aa    MW: 41494.2 Da    PI: 5.0074
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10020457mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF5731361.2e-42155247297
           DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskki 95 
                      +fqrlw+e+Dei++LqG+idfka+tgksp++d++afy+f+kksisf+vsk+q+++Kir+L+kK++ k k+   g epsfsk+hdqk++elsk i
  Carubv10020457m 155 AFQRLWTEDDEIAVLQGMIDFKADTGKSPYEDTNAFYDFIKKSISFEVSKNQFMDKIRSLRKKYTAKGKT---GVEPSFSKAHDQKSYELSKFI 245
                      69***************************************************************99888...********************* PP

           DUF573  96 Wg 97 
                      Wg
  Carubv10020457m 246 WG 247
                      *9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.9E-34156247IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MTKKLNPLED PPTASSSEDE DVETSEAGEA SDDSSSSEED ESSKIPIKSL ASKSTAAAAV  60
AAPSKPATAA DSDSGSETET DSDSESTNPP NSGSGKTISV NLKKKEDSTS YAALALPAVK  120
SGAKRPASEA AASAKRVKVV TSGGGGEEES VKKPAFQRLW TEDDEIAVLQ GMIDFKADTG  180
KSPYEDTNAF YDFIKKSISF EVSKNQFMDK IRSLRKKYTA KGKTGVEPSF SKAHDQKSYE  240
LSKFIWGPDG FALESNIKSN GVSRKSQSKS KKKIDSVKQE LVFAGSSPNG KKVEDGDDED  300
VIVRGGDSRK PDWFVNSALF RMITTLGVDE YTLKYKWSLV PDETKKIVEG KFKKLQDMEL  360
DFLLEKADLL HDLTAMIIEA SKK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2545770.0AC254577.1 Capsella rubella clone JGIBSIA-13B13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302389.10.0hypothetical protein CARUB_v10020457mg
TrEMBLR0GHD80.0R0GHD8_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.2__286__AT1G61730.11e-149(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.11e-102DNA-binding storekeeper protein-related transcriptional regulator