PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10019812m
Common NameCARUB_v100198120mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family Nin-like
Protein Properties Length: 815aa    MW: 91292.7 Da    PI: 6.3082
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10019812mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK94.85.7e-30546597152
           RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      aek+i+le+l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Carubv10019812m 546 AEKNITLEVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 597
                      589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.405531617IPR003035RWP-RK domain
PfamPF020426.4E-26549597IPR003035RWP-RK domain
SuperFamilySSF542774.66E-23705802No hitNo description
SMARTSM006663.1E-24716799IPR000270PB1 domain
PROSITE profilePS5174526.565716799IPR000270PB1 domain
CDDcd064071.98E-36717793No hitNo description
PfamPF005642.0E-17717797IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.1E-19717796No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 815 aa     Download sequence    Send to blast
MENNSLPIDP AMDSSFMDGL LLEGCWLETT DASEFLNFSP STSVTPFDPS SFMWSPTQDT  60
AICSSNSLSH MYGQVVAERS SIEDQGRDLS SFNRRWWIGP SGHGSSVMER LVQAVTHIKD  120
FTSERGSLIQ LWVPVDRGGK RVLTTKEQPF SHDPMCQRLA HYREISVNYQ FSTEQEDSGS  180
SSNDLVGLPG RVFLGKVPEW TPDVRFFKNE EYPRVQHAQD CDVRGTLAIP VFEQGSQNCL  240
GVIEVVMTTQ MVKLSPDLDS ICRALQAVDL RSTEVPIRPS LKGPDFSYQA ALPEIRNLLR  300
CACETHKLPL AQTWVSCLKQ SKTGCRHNDE NYIHCVSTID DACYVGDPTV REFHEACSEH  360
HLLKGQGVVG EAFLTNGPCF SSDVSSYKKS EYPLSHHATM FGLHGTVAIR LRCIHTGSVD  420
FVLEFFLPKN CRDIEEQKKM LNALSTIMAH VPRSLRTVTE KELEEGDLMA REVIERGVTL  480
PKIENPSEVP KSDSNLQNAG LVFDEGTTEM GEVGSDYGKG LSVNENSTFS SASGFSRMTE  540
KKRTKAEKNI TLEVLRQYFA GSLKDAAKSI GVCPTTLKRI CRQHGIQRWP SRKIKKVGHS  600
LQKIQRVIDS VEGVSGHHLP IGSFYANFPN LASSPEASSL QQQSKKTTFL FSSNSQPTKS  660
PGSSCSHSSS CSSETQVNKE DPKDKTRQET INLPRSFKER QTTHLSPSTS SQEDDFLRIK  720
VTYEEEKIRF RMRNSHRLND LLWEIAKRFS IEDVSRYDLK YLDEDNEWVL LRCDDDVEEC  780
VDVCRSFPGQ TIKLLLQLSS QYLSERSSAS GCPS*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10019812m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935370.0AB493537.1 Arabidopsis thaliana At1g76350 mRNA for hypothetical protein, partial cds, clone: RAAt1g76350.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006300747.10.0protein NLP5
SwissprotQ9SFW80.0NLP5_ARATH; Protein NLP5
TrEMBLR0I6G00.0R0I6G0_9BRAS; Uncharacterized protein
STRINGXP_006300747.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein