PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10019521m
Common NameCARUB_v10019521mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 254aa    MW: 28676.8 Da    PI: 4.6835
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10019521mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF343.8e-112362443
                     -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
           SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                     + k +r+v  skRr++++ KA  L+ L +a+vav + s+ 
  Carubv10019521m 23 DTKQQRSVACSKRRQTLFSKAANLCLLSGANVAVFVTSPA 62
                     56889********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006612.5871260IPR002100Transcription factor, MADS-box
SMARTSM004327.9E-171271IPR002100Transcription factor, MADS-box
CDDcd002662.78E-221397No hitNo description
SuperFamilySSF554551.83E-141496IPR002100Transcription factor, MADS-box
PfamPF003192.6E-102565IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MSSNVSDQMR RGTKRKIEIK KRDTKQQRSV ACSKRRQTLF SKAANLCLLS GANVAVFVTS  60
PAENSDVVYS FSGYSPASVI ADCYFSGKSP PKVTSNPQSK LGFWWEAPDL YRYCDDLSEL  120
NVIEDRMMRT KKYLMAFLEK QEKSQSLSDS DQNPSSSSLD QNPNFSSPSC SLEKICDESS  180
SQATCYTDDQ NPRFCESSSL DQSRYLVVKD DLDFVDSLWE TEKSITNEDQ SFWDNVFCLN  240
NDNNNLQVPL PDH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1915RRGTKRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10019521m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023638880.10.0LOW QUALITY PROTEIN: agamous-like MADS-box protein AGL97
TrEMBLR0H9P90.0R0H9P9_9BRAS; Uncharacterized protein
STRINGXP_006293201.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63951442
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48150.13e-83M-type_MADS family protein